Mothers against decapentaplegic homolog 8_9 - Smad8_9 MH1

{
  "code": "SASDE42",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Unveiling the dimer/monomer propensities of Smad MH1-DNA complexes",
    "publication": {
      "title": "Unveiling the dimer/monomer propensities of Smad MH1-DNA complexes",
      "author_list": "Ruiz L, Kaczmarska Z, Gomes T, Aragón E, Torner C, Freier R, Bagiński B, Martin-Malpartida P, de Martin Garrido N, Márquez J, Cordeiro T, Pluta R, Macias M",
      "journal": null,
      "doi": "10.1101/833319",
      "pmid": null,
      "published_date": "2019 Nov 07"
    },
    "status": "released",
    "submitted_date": "2018-07-24",
    "released_date": "2019-11-25"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE42.dat",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE42.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE42_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE42_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE42_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE42_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE42.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Mothers against decapentaplegic homolog 8_9",
          "short_name": "Smad8_9 MH1",
          "sequence": "GPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPP",
          "organism": "Homo sapiens",
          "uniprot_code": "O15198",
          "uniprot_range_first": 16,
          "uniprot_range_last": 141,
          "oligomerization": "unknown",
          "molecular_type": "protein",
          "uniprot_sequence": "MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALS\nCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK\nQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS\nFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQ\nSGQPVDATADRHVVLSIPNGDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDG\nFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSR\nNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVK\nGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS",
          "mw": 14.652,
          "total_mw": 14.652,
          "number_molecules": 0,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.2,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Mothers against decapentaplegic homolog 8_9 - Smad8_9 MH1",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "IRB",
            "address": "Barcelona, Spain",
            "full_name": "Institute for Research in Biomedicine in Barcelona (IRB)",
            "webpage": "https://www.irbbarcelona.org"
          }
        ],
        "contributor_name": "Tiago",
        "contributor_surname": "Lopes",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-03-01",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 1.0,
    "number_of_frames": 10,
    "wavelength": 0.09919,
    "sample_detector_distance": 2.87,
    "concentration_min": null,
    "concentration_max": 7.69,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.295,
    "s_max": 4.928,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ScÅtter",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of mothers against decapentaplegic homolog 8_9 (Smad8_9 MH1) in 20 mM Tris 150 mM NaCl, pH 7.2 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-to-detector distance of 2.87 m and an X-ray wavelength, λ, of 0.09919 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 7.69 mg/ml was measured at 10°C. 10 successive 1 s frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The data is recorded from a sample in monomer-dimer equilibrium.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 19.5,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 65.90187,
  "pddf_i0_error": null,
  "guinier_i0": 16.44,
  "guinier_i0_error": 0.024,
  "pddf_rg": 1.85,
  "pddf_rg_error": null,
  "guinier_rg": 1.93,
  "guinier_rg_error": 0.12,
  "pddf_dmax": 6.45,
  "pddf_dmax_error": null,
  "porod_volume": 34.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 4,
  "guinier_point_last": 69,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDE42_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-02-27T12:29:13.920744+01:00",
  "bragg_peak": []
}

{
  "code": "SASDE42",
  "status": "success",
  "started_at": "2026-08-11T13:29:57.684719+00:00",
  "finished_at": "2026-08-11T13:30:04.874626+00:00",
  "source_last_modified": "2021-02-27T12:29:13.920744+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDE42/",
      "path": "/data/saxsdb/sasbdb/entries/42/sasde42/source/summary.json",
      "size": 6549,
      "sha256": "6aae3764db30cc24d834e2c7c44941bda8926ba701404d46647db11ec756b3de"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDE42.dat",
      "path": "/data/saxsdb/sasbdb/entries/42/sasde42/source/SASDE42.dat",
      "size": 39816,
      "sha256": "85af3fb89c41d8b065ed20d9a059ba6ea64e5a53e74db3068d6aa6f6ff89594b",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDE42.dat",
      "path": "/data/saxsdb/sasbdb/entries/42/sasde42/source/SASDE42.out",
      "size": 4523,
      "sha256": "4d15faf2300a320e14752260443effddffe7f32a4934e1cf59027c5f79f7372d",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE42.sascif",
      "path": "/data/saxsdb/sasbdb/entries/42/sasde42/source/SASDE42.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDE42.zip",
      "path": "/data/saxsdb/sasbdb/entries/42/sasde42/source/SASDE42.zip",
      "size": 14514,
      "sha256": "ee0601b3ad58e3951561fd650a19545858a17f9f9a3a95ac73a937b3cb8d3beb",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}