Aldehyde dehydrogenase 16 from Loktanella sp. (LsALDH16): 2 mg/ml

{
  "code": "SASDE47",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Crystal Structure of Aldehyde Dehydrogenase 16 Reveals Trans-Hierarchical Structural Similarity and a New Dimer.",
    "publication": {
      "title": "Crystal Structure of Aldehyde Dehydrogenase 16 Reveals Trans-Hierarchical Structural Similarity and a New Dimer.",
      "author_list": "Liu LK, Tanner JJ",
      "journal": "J Mol Biol",
      "doi": "10.1016/j.jmb.2018.11.030",
      "pmid": "30529746",
      "published_date": "2018 Dec 7"
    },
    "status": "released",
    "submitted_date": "2018-10-30",
    "released_date": "2018-12-13"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE47.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE47.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE47_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE47_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE47_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE47_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE47.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 X 2M",
        "resolution": 172.0
      },
      "name": "Advanced Light Source (ALS)",
      "city": "Berkeley, CA",
      "country": "USA",
      "beamline_name": "12.3.1 (SIBYLS)",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Aldehyde dehydrogenase 16 from Loktanella sp.",
          "short_name": "LsALDH16",
          "sequence": "MTVKEIFETMDYGPAPESAKEAYAWLAEKGDFGHFIGGAWTAPGDLFATVNPATGQTLAQ\r\nVSQATQADVDAAVKAARKAQPAWAKDGAARARVLYALARLLQKHARLFAVLETLDNGKPI\r\nREARDIDVPLAQRHFYHHAGYAQLMGTEMPDRAPLGVCGQVIPWNFPLLMLAWKIAPALA\r\nMGNTVVLKPAEWTPLTALLFADICGQAGVPAGVVNIVTGDGAVGEMIVTAQVDKVAFTGS\r\nTAVGRRIREATAGTGKALSLELGGKGPYVVCDDADIDSAVEGLVDAIWFNQGQVCCAGSR\r\nLLVQEGIADVFHAKLRARMDSLRIGDPLDKCIDIGAMVHPDQLARVRDMVAANTDGEVYQ\r\nTAVPAGCYYPPTLISGLAPASPLMQQEIFGPVLVSTTFRTPAEAVEIANNTAYGLAASVW\r\nSENVNLALDLAPKLVAGIVWINGTNMMDAAAPFGGVRESGFGREGGWEGLAGYTRPAIAT\r\nKSPAAVAAYTGDGAADGLDRTAKLYIGGKQTRPDGGYSRAVYGPKGKLLGHASLSNRKDL\r\nRNAVEAMNAASGWSRTTGHLRAQILYFIGENLSARADEFANRIKDMTGKDGKAEVAASID\r\nRLFSAAAWADKYDGQVKGVPLRGVALAMKEPVGKIGILCPDAAPLLGLVSLMAPAIAMGN\r\nRVTLAASEAFPLAATDFYQVLDTSDVPAGVVNILTGAHADLAEPMARHLDLDAVWGLSGH\r\nAQVIEAASAGNLKRSWTGPFDPAHDHTRDILSHATEVKTIWVPYGA",
          "organism": "Loktanella sp. 3ANDIMAR09",
          "uniprot_code": "A0A0Q3EUQ3",
          "uniprot_range_first": 1,
          "uniprot_range_last": 766,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MTVKEIFETMDYGPAPESAKEAYAWLAEKGDFGHFIGGAWTAPGDLFATVNPATGQTLAQ\nVSQATQADVDAAVKAARKAQPAWAKDGAARARVLYALARLLQKHARLFAVLETLDNGKPI\nREARDIDVPLAQRHFYHHAGYAQLMGTEMPDRAPLGVCGQVIPWNFPLLMLAWKIAPALA\nMGNTVVLKPAEWTPLTALLFADICGQAGVPAGVVNIVTGDGAVGEMIVTAQVDKVAFTGS\nTAVGRRIREATAGTGKALSLELGGKGPYVVCDDADIDSAVEGLVDAIWFNQGQVCCAGSR\nLLVQEGIADVFHAKLRARMDSLRIGDPLDKCIDIGAMVHPDQLARVRDMVAANTDGEVYQ\nTAVPAGCYYPPTLISGLAPASPLMQQEIFGPVLVSTTFRTPAEAVEIANNTAYGLAASVW\nSENVNLALDLAPKLVAGIVWINGTNMMDAAAPFGGVRESGFGREGGWEGLAGYTRPAIAT\nKSPAAVAAYTGDGAADGLDRTAKLYIGGKQTRPDGGYSRAVYGPKGKLLGHASLSNRKDL\nRNAVEAMNAASGWSRTTGHLRAQILYFIGENLSARADEFANRIKDMTGKDGKAEVAASID\nRLFSAAAWADKYDGQVKGVPLRGVALAMKEPVGKIGILCPDAAPLLGLVSLMAPAIAMGN\nRVTLAASEAFPLAATDFYQVLDTSDVPAGVVNILTGAHADLAEPMARHLDLDAVWGLSGH\nAQVIEAASAGNLKRSWTGPFDPAHDHTRDILSHATEVKTIWVPYGA",
          "mw": 80.704,
          "total_mw": 161.408,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris-HCl, 100 mM NaCl, 2.0% glycerol, 0.5 mM Tris(3-hydroxypropyl)phosphine",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Aldehyde dehydrogenase 16 from Loktanella sp. (LsALDH16): 2 mg/ml",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "Mizzou",
            "address": "Columbia, MO, USA",
            "full_name": "University of Missouri-Columbia",
            "webpage": "http://missouri.edu/"
          }
        ],
        "contributor_name": "Li-Kai",
        "contributor_surname": "Liu",
        "orcid": "https://orcid.org/0000-0001-9759-7250"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-12-13",
    "storage_temperature": null,
    "cell_temperature": 10.0,
    "exposure_time": 0.3,
    "number_of_frames": 32,
    "wavelength": 0.127,
    "sample_detector_distance": 1.5,
    "concentration_min": null,
    "concentration_max": 2.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.131,
    "s_max": 5.642,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDE47_fit1_model1_img.png",
          "software": "PyMOL",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDE47_fit1_model1.pdb",
          "model_mw": 157.1,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 386
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/Ls16A1_refine_93dimer_E4_Ls16A1_lo_fit_img.png",
      "software": "FoXS",
      "chi_square_value": 0.130601,
      "p_value": 0.0,
      "fit_residual_plot": "Ls16A1_refine_93dimer_E4_Ls16A1_lo_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDE47_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of aldehyde dehydrogenase 16 from Loktanella sp. (LsALDH16) in 20 mM Tris-HCl, 100 mM NaCl, 2.0% glycerol, 0.5 mM Tris(3-hydroxypropyl)phosphine, pH 8 were collected on the 12.3.1 (SIBYLS) beam line at the Advanced Light Source (ALS; Berkeley, CA, USA) using a Pilatus3 X 2M detector at a sample-detector distance of 1.5 m and at a wavelength of λ = 0.127 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.00 mg/ml was measured at 10°C. 32 successive 0.300 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 141.5,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 268.0,
  "pddf_i0_error": null,
  "guinier_i0": 267.76,
  "guinier_i0_error": 0.78,
  "pddf_rg": 3.55,
  "pddf_rg_error": null,
  "guinier_rg": 3.56,
  "guinier_rg_error": 1.0,
  "pddf_dmax": 10.9,
  "pddf_dmax_error": null,
  "porod_volume": 202.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 6,
  "guinier_point_last": 42,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDE47_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDE47",
  "status": "success",
  "started_at": "2026-08-11T15:21:40.230530+00:00",
  "finished_at": "2026-08-11T15:21:50.169690+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDE47/",
      "path": "/data/saxsdb/sasbdb/entries/47/sasde47/source/summary.json",
      "size": 8710,
      "sha256": "18046a7bab3c20fb01603663af2a66184ca4fbd5ccc6aaee7571ea1811b2c9ca"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDE47.dat",
      "path": "/data/saxsdb/sasbdb/entries/47/sasde47/source/SASDE47.dat",
      "size": 26956,
      "sha256": "56988e7958f3841c53d2c7edae76ecafff2dd9a65ada22c097177c03f316308b",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDE47.out",
      "path": "/data/saxsdb/sasbdb/entries/47/sasde47/source/SASDE47.out",
      "size": 51986,
      "sha256": "86df6c07389b2e90b3af47b4baff70ad41c58c98c2386bee6f7dfa844bbd9430",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE47.sascif",
      "path": "/data/saxsdb/sasbdb/entries/47/sasde47/source/SASDE47.sascif",
      "size": 1271474,
      "sha256": "e4124d675c8bbc06de4751e5f4c56b732c5285875471266b2c982553aec90e67",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDE47.zip",
      "path": "/data/saxsdb/sasbdb/entries/47/sasde47/source/SASDE47.zip",
      "size": 268063,
      "sha256": "c738325ee92c3b5bfc4d75da7d21da3ef85f1cf458d22a8220ad649b9bd1be00",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}