The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDE54",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Inhibitor-induced dimerization of an essential oxidoreductase from African Trypanosomes.",
"publication": {
"title": "Inhibitor-induced dimerization of an essential oxidoreductase from African Trypanosomes.",
"author_list": "Wagner A, Le TA, Brennich M, Klein P, Bader N, Diehl E, Paszek D, Weickhmann AK, Dirdjaja N, Krauth-Siegel RL, Engels B, Opatz T, Schindelin H, Hellmich UA",
"journal": "Angew Chem Int Ed Engl",
"doi": "10.1002/anie.201810470",
"pmid": "30605929",
"published_date": "2019 Jan 3"
},
"status": "released",
"submitted_date": "2018-09-06",
"released_date": "2019-01-08"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE54.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE54.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE54_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE54_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE54_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE54_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE54.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Tryparedoxin W39A",
"short_name": null,
"sequence": "GSGLAKYLPGATNLLSKSGEVSLGSLVGKTVFLYFSASACPPCRG\r\nFTPVLAEFYEKHHVAKNFEVVLISWDENESDFHDYYGKMPWLALPFDQRSTVSELGKTFG\r\nVESIPTLITINADTGAIIGTQARTRVIEDPDGANFPWPN",
"organism": "Trypanosoma brucei brucei",
"uniprot_code": "O77404",
"uniprot_range_first": 2,
"uniprot_range_last": 144,
"oligomerization": "unknown",
"molecular_type": "protein",
"uniprot_sequence": "MSGLAKYLPGATNLLSKSGEVSLGSLVGKTVFLYFSASWCPPCRGFTPVLAEFYEKHHVA\nKNFEVVLISWDENESDFHDYYGKMPWLALPFDQRSTVSELGKTFGVESIPTLITINADTG\nAIIGTQARTRVIEDPDGANFPWPN",
"mw": 15.702,
"total_mw": 15.702,
"number_molecules": 0,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10 mM HEPES pH 7.5, 50 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Tryparedoxin W39A, in the presence of inhibitor CFT (2-(chloromethyl)-5-(4-fluorophenyl)thieno[2,3-d]pyrimidin-4(3H)-one)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL",
"address": "Grenoble, France",
"full_name": "European Molecular Biology Laboratory (EMBL) - Grenoble Outstation",
"webpage": "https://www.embl.fr/"
}
],
"contributor_name": "Martha",
"contributor_surname": "Brennich",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-05-31",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": null,
"wavelength": 0.099,
"sample_detector_distance": 2.869,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.037,
"s_max": 4.928,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDE54_fit1_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "6gxy",
"ext_code": "6GXY",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDE54_fit1_model1.pdb",
"model_mw": 31.77,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 119
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDE54_fit1_model2_img.png",
"software": "Other",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDE54_fit1_model2.pdb",
"model_mw": 15.88,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 119
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/TpxW39AC1_960_980_crp_fit_img.png",
"software": "OLIGOMER",
"chi_square_value": 1.87,
"p_value": 2e-06,
"fit_residual_plot": "TpxW39AC1_960_980_crp_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDE54_fit1.fit",
"fit_log": null,
"software_version": null,
"description": "Fit to mixture of crystallographic monomer and dimer: 100% monomer"
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "SEC column type: GE Healthcare S75 3.2/300; Sample Injection Concentration = 10 mg/mL;\r\nColumn flow-rate = 0.1 mL/min.",
"experiment_description": "Synchrotron SAXS data from solutions of Tryparedoxin W39A, in the presence of CFT in 10 mM HEPES pH 7.5, 50 mM NaCl, pH 7.5 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Dectris Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). The data were collected using in-line size exclusion chromatography (SEC)-SAXS at 20°C.",
"tags": [],
"intensity_unit": null,
"experimental_mw": 15.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 15.0,
"porod_mw_error": null,
"pddf_i0": 8.247,
"pddf_i0_error": null,
"guinier_i0": 8.25,
"guinier_i0_error": 0.01,
"pddf_rg": 1.6,
"pddf_rg_error": null,
"guinier_rg": 1.6,
"guinier_rg_error": 0.01,
"pddf_dmax": 5.83,
"pddf_dmax_error": null,
"porod_volume": 26.07,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 29,
"guinier_point_last": 165,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDE54_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-11-27T12:14:25.866104+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDE54",
"status": "success",
"started_at": "2026-08-11T14:14:01.104396+00:00",
"finished_at": "2026-08-11T14:14:10.227259+00:00",
"source_last_modified": "2020-11-27T12:14:25.866104+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDE54/",
"path": "/data/saxsdb/sasbdb/entries/54/sasde54/source/summary.json",
"size": 8070,
"sha256": "e0f59988cb26835f14872adf0ec6dbaf0cd091f8bb4736c9348d1d76647caf3a"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDE54.dat",
"path": "/data/saxsdb/sasbdb/entries/54/sasde54/source/SASDE54.dat",
"size": 49771,
"sha256": "da5b47aec0a61024383bbfe068a79553bea7bafeb79891e550d51d40228f2afa",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDE54.out",
"path": "/data/saxsdb/sasbdb/entries/54/sasde54/source/SASDE54.out",
"size": 85242,
"sha256": "2630d90ec953f7d7ada47348443feb0dbfa06040b150e30b5c69fd066235ef88",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE54.sascif",
"path": "/data/saxsdb/sasbdb/entries/54/sasde54/source/SASDE54.sascif",
"size": 550063,
"sha256": "6219544ee090ac394d2c09143c88533cb4d275fff4c47f83e2e19196012d9988",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDE54.zip",
"path": "/data/saxsdb/sasbdb/entries/54/sasde54/source/SASDE54.zip",
"size": 125002,
"sha256": "3d7f63be1a0bf84a59cd748c29ad7534ca97c8f373f071e2c2f38f7306b594f2",
"role": "full_entry_zip",
"zip_member_count": 5,
"zip_validation": "central_directory_readable"
}
]
}
