Solution structure of phosphoglucosamine mutase (GlmM) from Staphylococcus aureus

{
  "code": "SASDE88",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "Inhibition of the Staphylococcus aureus c-di-AMP cyclase DacA by direct interaction with the phosphoglucosamine mutase GlmM.",
    "publication": {
      "title": "Inhibition of the Staphylococcus aureus c-di-AMP cyclase DacA by direct interaction with the phosphoglucosamine mutase GlmM.",
      "author_list": "Tosi T, Hoshiga F, Millership C, Singh R, Eldrid C, Patin D, Mengin-Lecreulx D, Thalassinos K, Freemont P, Gründling A",
      "journal": "PLoS Pathog",
      "doi": "10.1371/journal.ppat.1007537",
      "pmid": "30668586",
      "published_date": "2019 Jan 22"
    },
    "status": "released",
    "submitted_date": "2018-11-17",
    "released_date": "2019-01-28"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDE88.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDE88.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE88_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE88_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDE88_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDE88_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE88.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": "1 x 5 mm",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Phosphoglucosamine mutase",
          "short_name": "GlmM",
          "sequence": ">GlmM\r\nMGKYFGTDGVRGVANQELTPELAFKLGRYGGYVLAHNKGEKHPRVLVGRDTRVSGEMLESALIAGLISIGAEVMRLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFKLSDEQENEIEALLDQENPELPRPVGNDIVHYSDYFEGAQKYLSYLKSTVDVNFEGLKIALDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTHPEKLAEKVVETESDFGLAFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMIVSTVMSNLGFYKALEQEGIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASVIKMTGKSLSELAGQMKKYPQSLINVRVTDKYRVEENVDVKEVMTKVEVEMNGEGRILVRPSGTEPLVRVMVEAATDEDAERFAQQIADVVQDKMGLDKLVPR",
          "organism": "Staphylococcus aureus",
          "uniprot_code": "Q2FEX1",
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MGKYFGTDGVRGVANQELTPELAFKLGRYGGYVLAHNKGEKHPRVLVGRDTRVSGEMLES\nALIAGLISIGAEVMRLGIISTPGVAYLTRDMGAELGVMISASHNPVADNGIKFFGSDGFK\nLSDEQENEIEALLDQENPELPRPVGNDIVHYSDYFEGAQKYLSYLKSTVDVNFEGLKIAL\nDGANGSTSSLAPFLFGDLEADTETIGCSPDGYNINEKCGSTHPEKLAEKVVETESDFGLA\nFDGDGDRIIAVDENGQIVDGDQIMFIIGQEMHKNQELNNDMIVSTVMSNLGFYKALEQEG\nIKSNKTKVGDRYVVEEMRRGNYNLGGEQSGHIVMMDYNTTGDGLLTGIQLASVIKMTGKS\nLSELAGQMKKYPQSLINVRVTDKYRVEENVDVKEVMTKVEVEMNGEGRILVRPSGTEPLV\nRVMVEAATDEDAERFAQQIADVVQDKMGLDK",
          "mw": 49.731,
          "total_mw": 99.462,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "30 mM Tris, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Solution structure of phosphoglucosamine mutase (GlmM) from Staphylococcus aureus",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "London, UK",
            "full_name": "Imperial College London",
            "webpage": "https://www.imperial.ac.uk/"
          }
        ],
        "contributor_name": "Tommaso",
        "contributor_surname": "Tosi",
        "orcid": "https://orcid.org/0000-0002-4564-7807"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-05-07",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 3.0,
    "number_of_frames": null,
    "wavelength": 0.1,
    "sample_detector_distance": 4.014,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.079,
    "s_max": 3.144,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDE88_fit1_model1_img.png",
          "software": "DAMFILT",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "5.0",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDE88_fit1_model1.pdb",
          "model_mw": 85.402,
          "bead_radius": 3.25,
          "log": "https://www.sasbdb.org/media/log_files/damsel_40OBGnP.log",
          "symmetry": null,
          "comment": null,
          "user": 391
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/run_3_OmnuBRr_fit_img.png",
      "software": "DAMMIF",
      "chi_square_value": 1.218,
      "p_value": 0.363345,
      "fit_residual_plot": "run_3_OmnuBRr_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDE88_fit1.fir",
      "fit_log": null,
      "software_version": "5.0",
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of the GlmM in 30 mM Tris, 150 mM NaCl, pH 7.5 were collected using size-exclusion chromatography SAXS (SEC-SAXS)  on the B21 beam line at the Diamond Light Source (Oxfordshire, UK) using a Pilatus 2M detector at a sample-to-detector distance of 4.014 m and X-ray wavelength of λ = 0.1 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SEC-SAXS was performed at 20°C using the following parameters: Column: Superdex 200 5/150 (GE Healthcare); Flow rate: 0.075 mL/min; Sample injection concentration: 12.0 mg/mL; Injection volume: 45 μL. The data obtained through the sample elution peak (collected as consecutive 3 s exposures) were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted and the individual subtracted data sets were scaled and averaged to generate the scattering profile displayed in this entry.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 94.2,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 84.0,
  "porod_mw_error": null,
  "pddf_i0": 0.1142,
  "pddf_i0_error": null,
  "guinier_i0": 0.1137,
  "guinier_i0_error": 0.001,
  "pddf_rg": 3.77,
  "pddf_rg_error": null,
  "guinier_rg": 3.68,
  "guinier_rg_error": 0.01,
  "pddf_dmax": 12.46,
  "pddf_dmax_error": null,
  "porod_volume": 134.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 2,
  "guinier_point_last": 115,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDE88_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDE88",
  "status": "success",
  "started_at": "2026-08-11T15:47:39.306459+00:00",
  "finished_at": "2026-08-11T15:47:47.709444+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDE88/",
      "path": "/data/saxsdb/sasbdb/entries/88/sasde88/source/summary.json",
      "size": 8305,
      "sha256": "b40a78fd0344b9af5fcff43fb860d9ef17b33181d3fb0879809f76bbfa9cb360"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDE88.dat",
      "path": "/data/saxsdb/sasbdb/entries/88/sasde88/source/SASDE88.dat",
      "size": 67972,
      "sha256": "1d660667e993437a784bced61ec1e22d8edef170bf91fa1961692dcf92ce6179",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDE88.out",
      "path": "/data/saxsdb/sasbdb/entries/88/sasde88/source/SASDE88.out",
      "size": 85370,
      "sha256": "c9a6f5dce1428f2d3fea37f75f61514cfcca95b7779a55a04ba1f176ccff2e55",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDE88.sascif",
      "path": "/data/saxsdb/sasbdb/entries/88/sasde88/source/SASDE88.sascif",
      "size": 269197,
      "sha256": "e828722b7fd274a02f8e4a65f5fa62f3f5e147127793fcab6acd304901b07246",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDE88.zip",
      "path": "/data/saxsdb/sasbdb/entries/88/sasde88/source/SASDE88.zip",
      "size": 70336,
      "sha256": "6078ca5a4c1a6d77bba09539ca10ef85847fd372f7e07902b120c9f3ada26dee",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}