The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDED2",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Solution model of the intrinsically disordered polyglutamine tract-binding protein-1.",
"publication": {
"title": "Solution model of the intrinsically disordered polyglutamine tract-binding protein-1.",
"author_list": "Rees M, Gorba C, de Chiara C, Bui TT, Garcia-Maya M, Drake AF, Okazawa H, Pastore A, Svergun D, Chen YW",
"journal": "Biophys J",
"doi": "10.1016/j.bpj.2012.02.047",
"pmid": "22500761",
"published_date": "2012 Apr 4"
},
"status": "released",
"submitted_date": "2018-08-03",
"released_date": "2018-08-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDED2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDED2.csv",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDED2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDED2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDED2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDED2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDED2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Custom-built",
"name": "Pilatus 1M-W",
"resolution": 0.172
},
"name": "DORIS III, DESY",
"city": "Hamburg",
"country": "Germany",
"beamline_name": "EMBL X33",
"beam_geometry": "0.60",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Polyglutamine-binding protein 1",
"short_name": "PQBP-1",
"sequence": ">sp|O60828|PQBP1_HUMAN Polyglutamine-binding protein 1 OS=Homo sapiens\r\nGPMPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSC\r\nGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRS\r\nHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHR\r\nREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLF\r\nQQRPYPSPGAVLRANAEASRTKQQD",
"organism": "Homo sapiens",
"uniprot_code": "O60828",
"uniprot_range_first": 1,
"uniprot_range_last": 265,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSC\nGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRS\nHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHR\nREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLF\nQQRPYPSPGAVLRANAEASRTKQQD",
"mw": 30.626,
"total_mw": 30.626,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris, 150 mM NaCl, 1mM DTT,",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Polyglutamine tract-binding protein 1 (PQBP-1)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "London, UK",
"full_name": "King's College London",
"webpage": "https://www.kcl.ac.uk"
}
],
"contributor_name": "Yu Wai",
"contributor_surname": "Chen",
"orcid": "http://orcid.org/0000-0001-7833-7533"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2009-11-18",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 15.0,
"number_of_frames": 8,
"wavelength": 0.15,
"sample_detector_distance": 2.7,
"concentration_min": 7.0,
"concentration_max": 13.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.077,
"s_max": 6.208,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDED2_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 0.857,
"p_value": 0.0,
"fit_residual_plot": "fit4columns1607_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDED2_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/GA001_LZEuVwU.log",
"software_version": null,
"description": null
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDED2_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "1.1.0 r980",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDED2_fit2_model1.pdb",
"model_mw": 40.3,
"bead_radius": 2.7,
"log": null,
"symmetry": null,
"comment": null,
"user": 342
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDED2_fit2_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.018081,
"p_value": 0.058031,
"fit_residual_plot": "SASDED2_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDED2_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/SVD_1_4.log",
"software_version": "1.1.0",
"description": null
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.5a",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of polyglutamine tract-binding protein 1 (PQBP-1) in 20 mM Tris, 150 mM NaCl, 1mM DTT, pH 7 were collected on the EMBL X33 beam line at DORIS III (Hamburg, Germany) using a Pilatus 1M-W detector at a sample-detector distance of 2.7 m and at a wavelength of λ = 0.15 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 7 and 13 mg/ml were measured at 20°C. Eight successive 15 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [
"idp",
"X33"
],
"intensity_unit": "arbitrary",
"experimental_mw": 30.6,
"experimental_mw_error": null,
"guinier_i0_mw": 30.0,
"guinier_i0_mw_error": 3.0,
"porod_mw": 35.0,
"porod_mw_error": null,
"pddf_i0": 40.75,
"pddf_i0_error": null,
"guinier_i0": 40.49,
"guinier_i0_error": null,
"pddf_rg": 3.82,
"pddf_rg_error": null,
"guinier_rg": 3.72,
"guinier_rg_error": 0.2,
"pddf_dmax": 13.0,
"pddf_dmax_error": null,
"porod_volume": 51.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 30,
"guinier_point_last": 97,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDED2_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-05-25T11:21:52.654103+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDED2",
"status": "success",
"started_at": "2026-08-11T13:35:57.628006+00:00",
"finished_at": "2026-08-11T13:36:11.916899+00:00",
"source_last_modified": "2023-05-25T11:21:52.654103+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDED2/",
"path": "/data/saxsdb/sasbdb/entries/d2/sasded2/source/summary.json",
"size": 8327,
"sha256": "0929084c222aff6441643a14417cd3f331296eb28c3880b9cd3b00f7c9cc3a00"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDED2.csv",
"path": "/data/saxsdb/sasbdb/entries/d2/sasded2/source/SASDED2.dat",
"size": 254979,
"sha256": "143c6d3a1a7db7062f6c292d0da94246bd62aa8d54287113357c6742be7817e6",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDED2.out",
"path": "/data/saxsdb/sasbdb/entries/d2/sasded2/source/SASDED2.out",
"size": 39726,
"sha256": "aa0b88de36f201741717f8b8f2e7319b75360e551e0345ca04932fff0180d0e1",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDED2.sascif",
"path": "/data/saxsdb/sasbdb/entries/d2/sasded2/source/SASDED2.sascif",
"size": 357396,
"sha256": "5e12d31b7ba7e965470e902b8aecc337f970e6ea69a53ddf3429fb38f91d8108",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDED2.zip",
"path": "/data/saxsdb/sasbdb/entries/d2/sasded2/source/SASDED2.zip",
"size": 73882,
"sha256": "63d08ffcc5052a96e66f80d38dfc134ea49216c49975fe82a7b2caba33a3ed14",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
