The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDEF5",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Crystal structure of a xylulose 5-phosphate phosphoketolase. insights into the substrate specificity for xylulose 5-phosphate.",
"publication": {
"title": "Crystal structure of a xylulose 5-phosphate phosphoketolase. insights into the substrate specificity for xylulose 5-phosphate.",
"author_list": "Scheidig AJ, Horvath D, Szedlacsek SE",
"journal": "J Struct Biol",
"doi": "10.1016/j.jsb.2019.04.017",
"pmid": "31059775",
"published_date": "2019 May 3"
},
"status": "released",
"submitted_date": "2018-09-30",
"released_date": "2019-05-08"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEF5.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEF5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEF5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEF5_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEF5_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEF5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEF5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Probable phosphoketolase",
"short_name": null,
"sequence": "MSHHHHHHSMDIEFVDLEGSMTEYNSEAYLKKLDKWWRAATYLGAGMIFLKENPLFSVTGTPIKAENL\r\nKANPIGHWGTVSGQTFLYAHANRLINKYDQKMFYMGGPGHGGQAMVVPSYLDGSYTEAY\r\nPEITQDLEGMSRLFKRFSFPGGIGSHMTAQTPGSLHEGGELGYVLSHATGAILDQPEQI\r\nAFAVVGDGEAETGPLMTSWHSIKFINPKNDGAILPILDLNGFKISNPTLFARTSDVDIR\r\nKFFEGLGYSPRYIENDDIHDYMAYHKLAAEVFDKAIEDIHQIQKDAREDNRYQNGEIPA\r\nWPIVIARLPKGWGGPRYNDWSGPKFDGKGMPIEHSFRAHQVPLPLSSKNMGTLPEFVKW\r\nMTSYQPETLFNADGSLKEELRDFAPKGEMRMASNPVTNGGVDSSNLVLPDWQEFANPIS\r\nENNRGKLLPDTNDNMDMNVLSKYFAEIVKLNPTRFRLFGPDETMSNRFWEMFKVTNRQW\r\nMQVIKNPNDEFISPEGRIIDSQLSEHQAEGWLEGYTLTGRTGAFASYESFLRVVDSMLT\r\nQHFKWIRQAADQKWRHDYPSLNVISTSTVFQQDHNGYTHQDPGMLTHLAEKKSDFIRQY\r\nLPADGNTLLAVFDRAFQDRSKINHIVASKQPRQQWFTKEEAEKLATDGIATIDWASTAK\r\nDGEAVDLVFASAGAEPTIETLAALHLVNEVFPQAKFRYVNVVELGRLQKKKGALNQERE\r\nLSDEEFEKYFGPSGTPVIFGFHGYEDLIESIFYQRGHDGLIVHGYREDGDITTTYDMRV\r\nYSELDRFHQAIDAMQVLYVNRKVNQGLAKAFIDRMKRTLVKHFEVTRNEGVDIPDFTEW\r\nVWSDLKK",
"organism": "Lactococcus lactis subsp. lactis",
"uniprot_code": "Q9CFH4",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MTEYNSEAYLKKLDKWWRAATYLGAGMIFLKENPLFSVTGTPIKAENLKANPIGHWGTVS\nGQTFLYAHANRLINKYDQKMFYMGGPGHGGQAMVVPSYLDGSYTEAYPEITQDLEGMSRL\nFKRFSFPGGIGSHMTAQTPGSLHEGGELGYVLSHATGAILDQPEQIAFAVVGDGEAETGP\nLMTSWHSIKFINPKNDGAILPILDLNGFKISNPTLFARTSDVDIRKFFEGLGYSPRYIEN\nDDIHDYMAYHKLAAEVFDKAIEDIHQIQKDAREDNRYQNGEIPAWPIVIARLPKGWGGPR\nYNDWSGPKFDGKGMPIEHSFRAHQVPLPLSSKNMGTLPEFVKWMTSYQPETLFNADGSLK\nEELRDFAPKGEMRMASNPVTNGGVDSSNLVLPDWQEFANPISENNRGKLLPDTNDNMDMN\nVLSKYFAEIVKLNPTRFRLFGPDETMSNRFWEMFKVTNRQWMQVIKNPNDEFISPEGRII\nDSQLSEHQAEGWLEGYTLTGRTGAFASYESFLRVVDSMLTQHFKWIRQAADQKWRHDYPS\nLNVISTSTVFQQDHNGYTHQDPGMLTHLAEKKSDFIRQYLPADGNTLLAVFDRAFQDRSK\nINHIVASKQPRQQWFTKEEAEKLATDGIATIDWASTAKDGEAVDLVFASAGAEPTIETLA\nALHLVNEVFPQAKFRYVNVVELGRLQKKKGALNQERELSDEEFEKYFGPSGTPVIFGFHG\nYEDLIESIFYQRGHDGLIVHGYREDGDITTTYDMRVYSELDRFHQAIDAMQVLYVNRKVN\nQGLAKAFIDRMKRTLVKHFEVTRNEGVDIPDFTEWVWSDLKK",
"mw": 95.727,
"total_mw": 191.454,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20mM potassium phosphate 150mM NaCl 0.007 %(w/v) β-octyl glucoside 1mM DTT 1mM MgCl 1mM thiaminpyrophosphate 2 %(v/v) glycerol",
"concentration_unit": null,
"comment": "SEC11 buffer",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Phosphoketolase (L. lactis) with 1 mM thiaminpyrophosphate and 2% v/v glycerol at pH 7.0",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Germany",
"full_name": "Kiel University",
"webpage": "https://www.uni-kiel.de"
}
],
"contributor_name": "Axel",
"contributor_surname": "Scheidig",
"orcid": "https://orcid.org/0000-0002-2382-8818"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-09-07",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.045,
"number_of_frames": 29,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 8.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.025,
"s_max": 5.064,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEF5_fit1_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "6gua",
"ext_code": "6GUA",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEF5_fit1_model1.pdb",
"model_mw": 186.9,
"bead_radius": null,
"log": null,
"symmetry": "P2",
"comment": "PDB-ID 6GUA is a tetramer of dimers; the dimer is supposed to be the biological assembly in solution",
"user": 366
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/pk7_ref82_AB_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 3.244,
"p_value": 0.0,
"fit_residual_plot": "pk7_ref82_AB_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEF5_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/pk7_ref82_AB.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEF5_fit2_model1_img.png",
"software": "SASREF",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEF5_fit2_model1.pdb",
"model_mw": 187.1,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/PKLl2mop.log",
"symmetry": "P1",
"comment": null,
"user": 366
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/PKLl2mop-1_fit_img.png",
"software": "SASREF",
"chi_square_value": 1.9,
"p_value": 0.0,
"fit_residual_plot": "PKLl2mop-1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEF5_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/PKLl2mop.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of phosphoketolase in 20mM potassium phosphate, 150mM NaCl, 0.007 %(w/v) β-octyl glucoside, 1mM DTT, 1mM MgCl2, 1mM thiaminpyrophosphate, 2 % v/v glycerol, pH 7 were collected on the EMBL P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 8.00 mg/ml was measured at 20°C. 29 successive 0.045 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 164.0,
"experimental_mw_error": null,
"guinier_i0_mw": 146.0,
"guinier_i0_mw_error": null,
"porod_mw": 148.0,
"porod_mw_error": null,
"pddf_i0": 21180.0,
"pddf_i0_error": null,
"guinier_i0": 21282.0,
"guinier_i0_error": 14.3,
"pddf_rg": 3.387,
"pddf_rg_error": null,
"guinier_rg": 3.44,
"guinier_rg_error": 0.55,
"pddf_dmax": 10.15,
"pddf_dmax_error": null,
"porod_volume": 237.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 34,
"guinier_point_last": 128,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDEF5_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDEF5",
"status": "success",
"started_at": "2026-08-11T14:47:00.832243+00:00",
"finished_at": "2026-08-11T14:47:12.527052+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEF5/",
"path": "/data/saxsdb/sasbdb/entries/f5/sasdef5/source/summary.json",
"size": 10360,
"sha256": "3cb992934b1117440c1fd7f3cdee47f05a8322f7d399fbda2bf35fec863157b4"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDEF5.dat",
"path": "/data/saxsdb/sasbdb/entries/f5/sasdef5/source/SASDEF5.dat",
"size": 83589,
"sha256": "d61d87e0c85a48739e51f2859c941ed17cac61e5070c2e0ca6cf90f34b3e86f6",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDEF5.out",
"path": "/data/saxsdb/sasbdb/entries/f5/sasdef5/source/SASDEF5.out",
"size": 73638,
"sha256": "e31765d3e2ba3074a730afe4c595c83dd0a99dc9d050f423b59956e01520fbc2",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEF5.sascif",
"path": "/data/saxsdb/sasbdb/entries/f5/sasdef5/source/SASDEF5.sascif",
"size": 3073686,
"sha256": "be43d7c6d4c090c8449a2acf9ff1d0fe385b2b618403f6fff83b68e8f2d0d6f6",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDEF5.zip",
"path": "/data/saxsdb/sasbdb/entries/f5/sasdef5/source/SASDEF5.zip",
"size": 617962,
"sha256": "8a98ab28270ad0664a5c2ccf61d0441219a91b65c9dc8d74f8ecebd4d5ae6f89",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
