SpaO C-terminus

{
  "code": "SASDEK7",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/nm",
  "project": {
    "title": "Molecular Organization of Soluble Type III Secretion System Sorting Platform Complexes.",
    "publication": {
      "title": "Molecular Organization of Soluble Type III Secretion System Sorting Platform Complexes.",
      "author_list": "Bernal I, Börnicke J, Heidemann J, Svergun D, Horstmann JA, Erhardt M, Tuukkanen A, Uetrecht C, Kolbe M",
      "journal": "J Mol Biol",
      "doi": "10.1016/j.jmb.2019.07.004",
      "pmid": "31288030",
      "published_date": "2019 Sep 6"
    },
    "status": "released",
    "submitted_date": "2018-11-02",
    "released_date": "2019-09-13"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEK7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEK7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEK7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEK7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEK7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEK7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEK7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Surface presentation of antigens protein SpaO(SPOA1,2) C-terminus",
          "short_name": "SpaO C-terminus",
          "sequence": ">SpaO_Cter\r\nMASWSHPQFEKGAVGGGRPKMLRWPLRFVIGSSDTQRSLLGRIGIGDVLLIRTSRAEVYCYAKKLGHFNRVEGGIIVETLDIQHIEEENNTTETAETLPGLNQLPVKLEFVLYRKNVTLAELEAMGQQQLLSLPTNAELNVEIMANGVLLGNGELVQMNDTLGVEIHEWLS",
          "organism": "Salmonella enterica subsp. enterica serovar Typhimurium",
          "uniprot_code": "P40699",
          "uniprot_range_first": 140,
          "uniprot_range_last": 297,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSLRVRQIDRREWLLAQTATECQRHGREATLEYPTRQGMWVRLSDAEKRWSAWIKPGDWL\nEHVSPALAGAAVSAGAEHLVVPWLAATERPFELPVPHLSCRRLCVENPVPGSALPEGKLL\nHIMSDRGGLWFEHLPELPAVGGGRPKMLRWPLRFVIGSSDTQRSLLGRIGIGDVLLIRTS\nRAEVYCYAKKLGHFNRVEGGIIVETLDIQHIEEENNTTETAETLPGLNQLPVKLEFVLYR\nKNVTLAELEAMGQQQLLSLPTNAELNVEIMANGVLLGNGELVQMNDTLGVEIHEWLSESG\nNGE",
          "mw": 19.0,
          "total_mw": 19.0,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM HEPES pH 7.5, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "SpaO C-terminus",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "EMBL-Hamburg",
            "address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
            "full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
            "webpage": "http://www.embl-hamburg.de/index.php"
          }
        ],
        "contributor_name": "Anne",
        "contributor_surname": "Tuukkanen",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-04-24",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 3600,
    "wavelength": 0.124,
    "sample_detector_distance": 3.0,
    "concentration_min": 12.5,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.284,
    "s_max": 5.025,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "SEC-SAXS was performed at 20°C using the following parameters: Column type, XXXX; Flow rate: XXXX mL/min; Total acquisition time: 60 min (3600 x 1 s frames); Injection concentration: XXXX mg/mL; Injection volume: XXXX μL.",
  "experiment_description": "Synchrotron SAXS data from solutions of SpaO C-terminus in 20 mM HEPES pH 7.5, 150 mM NaCl, pH 7.5 were collected on the EMBL P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). 3600 successive 1 second frames were collected at 20°C using size-exclusion chromatography SAXS. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 20.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 2930.0,
  "pddf_i0_error": null,
  "guinier_i0": 2948.54,
  "guinier_i0_error": 8.24,
  "pddf_rg": 2.138,
  "pddf_rg_error": null,
  "guinier_rg": 2.1,
  "guinier_rg_error": 0.2,
  "pddf_dmax": 7.2,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 5,
  "guinier_point_last": 120,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDEK7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:56:39.492710+02:00",
  "bragg_peak": []
}

{
  "code": "SASDEK7",
  "status": "success",
  "started_at": "2026-08-11T15:31:54.991250+00:00",
  "finished_at": "2026-08-11T15:32:03.831915+00:00",
  "source_last_modified": "2023-06-21T07:56:39.492710+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEK7/",
      "path": "/data/saxsdb/sasbdb/entries/k7/sasdek7/source/summary.json",
      "size": 6678,
      "sha256": "48d324a2120116465c67c00fee4a392e73bfce0ad092f4c07d07dd411094af4b"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDEK7.dat",
      "path": "/data/saxsdb/sasbdb/entries/k7/sasdek7/source/SASDEK7.dat",
      "size": 80383,
      "sha256": "ff2b5840c025a1c8a06408513aeb5cddd198d4b9bd51ddf0d22891ad028967b7",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDEK7.out",
      "path": "/data/saxsdb/sasbdb/entries/k7/sasdek7/source/SASDEK7.out",
      "size": 81510,
      "sha256": "0d198e526cc63e8f673af887b8a282c7ddc2e09dafa22ddbcbca2ef061eaa5b1",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEK7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/k7/sasdek7/source/SASDEK7.sascif",
      "size": 151483,
      "sha256": "fc3c9409b084f48f57db0f53b9ccb2d7a3b7ab0ac791513f05e327816b856a6f",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDEK7.zip",
      "path": "/data/saxsdb/sasbdb/entries/k7/sasdek7/source/SASDEK7.zip",
      "size": 44551,
      "sha256": "033dab44e0975f1e81ac86964b513e03e8777915a18c168b9147f804b0eb51c5",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}