Residues 478-884 of pseudorabies virus tegument protein UL37

{
  "code": "SASDEL4",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "The dynamic nature of the conserved tegument protein UL37 of herpesviruses.",
    "publication": {
      "title": "The dynamic nature of the conserved tegument protein UL37 of herpesviruses.",
      "author_list": "Koenigsberg AL, Heldwein EE",
      "journal": "J Biol Chem",
      "doi": "10.1074/jbc.RA118.004481",
      "pmid": "30166339",
      "published_date": "2018 Oct 12"
    },
    "status": "released",
    "submitted_date": "2018-07-16",
    "released_date": "2018-09-07"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEL4.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEL4.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEL4_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEL4_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEL4_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEL4_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEL4.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Pilatus",
        "name": "Pilatus 200K",
        "resolution": 172.0
      },
      "name": "Cornell High Energy Synchrotron Source (CHESS)",
      "city": "Ithaca, NY",
      "country": "USA",
      "beamline_name": "G1",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Tegument protein UL37",
          "short_name": "PRV UL37C",
          "sequence": "GPGSGLRADGAGETPMEAPTSAALVDLAAAADLVNYPSMVHLEAMADPSFAPFFVVTAVADAYNCLLTASYDRRADLAQVLTWARDYGAGLIPNVSGYRTKLAALVAALAREDLTVAHARNVEALAHELHGVVRAAAEVLEAPAPAPPSLAASAFLGDLLARALRRRLEDMATHTGDLLDSMATAAGAVAERVVALERLFTCRFVFRGRTASVFAPGEGGPCLGTWRLADVVDAVGAFRAEVNTHRSDMRADAGALRGVMAQTTEALRECEALGLQAPVFRTLCADHARLSKLQTSAALTAGRLQAATVLRPVERFLARWDLVSAALRRAVDERGVLALVATLRETWTEAREEQAPPAPAFTPEELREAADRVLGDYHEVAGDGEAGPDAVPLSASVNVRDWAAVNLEVLR",
          "organism": "Suid alphaherpesvirus 1",
          "uniprot_code": "Q911W0",
          "uniprot_range_first": 478,
          "uniprot_range_last": 884,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MEALVRALEEADHAVATVVQSRILEFFMAAGRETPAGVRGLWARALRLACRAYVETGTCE\nAAVLAENLAGLALWRLRHDWDEGTAPLLELLGVVNGDDTTAALTEAGLRTSAEFGPDAMF\nRLVSEWCAAFDEALAGARSADDVLAAPRVVPPEQTARALVQPRFATLYDMDFVQDGLRYV\nAQHTNWALPLALAVRQMQNEGLKPLTRALFALTIADEFFHDRQNPTLREQFAEAARAVDE\nAALVPVGEVNATPRTAVEVRVSAALAHGDAYVRELRPGTVARRLRTDQGVLALLDPGAQA\nVHVAAAADLDHTQVDATGVWEAVQASASPLQVVEALVTAGFTRRHCDLLERAVLDRAPRL\nTDAQRAVGCTAVVGGVVHRLLDDYGPGLDYVRAYTDVADTLEPLYGDVTAALGLPEKGVE\nHVVRHCMAPRPPTEHVGAARAALLREVAAAERRAGLAHSAAREALNTWLAFRAQSRWGLR\nADGAGETPMEAPTSAALVDLAAAADLVNYPSMVHLEAMADPSFAPFFVVTAVADAYNCLL\nTASYDRRADLAQVLTWARDYGAGLIPNVSGYRTKLAALVAALAREDLTVAHARNVEALAH\nELHGVVRAAAEVLEAPAPAPPSLAASAFLGDLLARALRRRLEDMATHTGDLLDSMATAAG\nAVAERVVALERLFTCRFVFRGRTASVFAPGEGGPCLGTWRLADVVDAVGAFRAEVNTHRS\nDMRADAGALRGVMAQTTEALRECEALGLQAPVFRTLCADHARLSKLQTSAALTAGRLQAA\nTVLRPVERFLARWDLVSAALRRAVDERGVLALVATLRETWTEAREEQAPPAPAFTPEELR\nEAADRVLGDYHEVAGDGEAGPDAVPLSASVNVRDWAAVNLEVLRRGARAPDDASAGVPLL\nAQTWVPVDRLLAEVDAVSK",
          "mw": 43.456,
          "total_mw": 43.456,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "100 mM HEPES 150 mM NaCl 5% glycerol 0.1 mM tris(2-carboxyethyl)phosphine (TCEP)",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Residues 478-884 of pseudorabies virus tegument protein UL37",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Somerville, MA, USA",
            "full_name": "Tufts University School of Medicine",
            "webpage": "https://www.tufts.edu/"
          }
        ],
        "contributor_name": "Andrea",
        "contributor_surname": "Koenigsberg",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-06-03",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 2.0,
    "number_of_frames": 300,
    "wavelength": 0.125,
    "sample_detector_distance": 1.5,
    "concentration_min": 6.0,
    "concentration_max": null,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.074,
    "s_max": 2.808,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEL4_fit1_model1_img.png",
          "software": "DAMMIN",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDEL4_fit1_model1.pdb",
          "model_mw": 51.935,
          "bead_radius": 6.4,
          "log": "https://www.sasbdb.org/media/log_files/pAK13_25_3.log",
          "symmetry": "None",
          "comment": null,
          "user": 343
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/pAK13_25_3_fit_img.png",
      "software": "DAMMIN",
      "chi_square_value": 1.077,
      "p_value": 0.37201,
      "fit_residual_plot": "pAK13_25_3_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEL4_fit1.fir",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/pAK13_25_3.log",
      "software_version": "5.3",
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data, I(s) vs s (where s = 4πsinθ/λ, and 2θ is the scattering angle), were measured from the C-terminal half of the Pseudorabiesvirus tegument protein UL37 using continuous-flow size-exclusion chromatography SAXS (SEC-SAXS) on the G1 beam line at the Cornell High Energy Synchrotron Source (CHESS; Ithaca, NY, USA). Data were collected a using a Pilatus 200K detector at a sample-detector distance of 1.5 m and at a wavelength of λ = 0.125 nm. The SEC mobile phase consisted of 100 mM HEPES, 150 mM NaCl, 5% glycerol, 0.1 mM tris(2-carboxyethyl)phosphine (TCEP), pH 7.5, (4°C). The SAXS data measured from the SEC-elution (sample peak and buffer; 300 successive 2 s frames) were normalized to the intensity of the transmitted beam and radially averaged. The scattering of an appropriate solvent-blank was subtracted from the sample frames to produce the scaled and averaged data displayed in this entry.",
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 44.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": 44.0,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.008036,
  "pddf_i0_error": null,
  "guinier_i0": 0.0081,
  "guinier_i0_error": 7e-05,
  "pddf_rg": 3.99,
  "pddf_rg_error": null,
  "guinier_rg": 3.86,
  "guinier_rg_error": 0.014,
  "pddf_dmax": 12.5,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": null,
  "guinier_point_last": null,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDEL4_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDEL4",
  "status": "success",
  "started_at": "2026-08-11T16:36:14.830420+00:00",
  "finished_at": "2026-08-11T16:36:22.662652+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEL4/",
      "path": "/data/saxsdb/sasbdb/entries/l4/sasdel4/source/summary.json",
      "size": 8626,
      "sha256": "2c6fdabf934ee80733a3acc82cb19c69f0ba1203627586b01ce2216a78bcedce"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDEL4.dat",
      "path": "/data/saxsdb/sasbdb/entries/l4/sasdel4/source/SASDEL4.dat",
      "size": 33429,
      "sha256": "6a9bac3a937d7aa22e0411612548ef9b7bc2b032c613c0947e192738137351f4",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDEL4.out",
      "path": "/data/saxsdb/sasbdb/entries/l4/sasdel4/source/SASDEL4.out",
      "size": 46186,
      "sha256": "a3e394f7077dd72627c41a576d021b97a40fd1f1612ad762ee44b594c609693b",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEL4.sascif",
      "path": "/data/saxsdb/sasbdb/entries/l4/sasdel4/source/SASDEL4.sascif",
      "size": 95165,
      "sha256": "7dc2c1d5fe6cecef8ae273d354d6021be7989965c4bdaa5b0eb219cb8af12c11",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDEL4.zip",
      "path": "/data/saxsdb/sasbdb/entries/l4/sasdel4/source/SASDEL4.zip",
      "size": 32889,
      "sha256": "e1e2b45b31a389fcca6d20ce9485d819cd771a38bc66259f9fa39f38168b5439",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}