The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDEM4",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Migration of Type III Secretion System Transcriptional Regulators Links Gene Expression to Secretion.",
"publication": {
"title": "Migration of Type III Secretion System Transcriptional Regulators Links Gene Expression to Secretion.",
"author_list": "Charova SN, Gazi AD, Mylonas E, Pozidis C, Sabarit B, Anagnostou D, Psatha K, Aivaliotis M, Beuzon CR, Panopoulos NJ, Kokkinidis M",
"journal": "MBio",
"doi": "10.1128/mBio.01096-18",
"pmid": "30065089",
"published_date": "2018 Jul 31"
},
"status": "released",
"submitted_date": "2018-09-14",
"released_date": "2018-09-14"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEM4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEM4.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEM4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEM4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEM4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEM4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEM4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "CCD",
"name": "AVIEX PCCD170170",
"resolution": null
},
"name": "SOLEIL",
"city": "Saint-Aubin",
"country": "France",
"beamline_name": "SWING",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Type III secretion protein HrpG",
"short_name": null,
"sequence": "MSYYHHHHHHDYDIPTTENLYFQGAMRSTELQQWAQRWLDDVGTDQQLTVDDGVVWLQRRADRFFALAELTINASLDDELLGRAL\r\nQLSAPTLRYFGRDAAALAQQGNSLILALAIRQLEVNAVCQQLESLLNQRDVWQTMLQQPR\r\nRKAATHGAVPLHSLAFLPRGNHG",
"organism": "Erwinia amylovora",
"uniprot_code": "D4HVP1",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MRSTELQQWAQRWLDDVGTDQQLTVDDGVVWLQRRADRFFALAELTINASLDDELLGRAL\nQLSAPTLRYFGRDAAALAQQGNSLILALAIRQLEVNAVCQQLESLLNQRDVWQTMLQQPR\nRKAATHGAVPLHSLAFLPRGNHG",
"mw": 19.166,
"total_mw": 19.166,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Type III secretion protein HrpV",
"short_name": null,
"sequence": "MNNPCPQVTSLSALLSLLQLRQSCRWPVQQGVELLALCGERGRELMLNLQPAFQPSGLYQ\r\nRLLSRRAQQLEIYDGCYLCLNHDRVLSCWRQLPESAMSDKQHIAQLFSLAGIHLAD",
"organism": "Erwinia amylovora",
"uniprot_code": "D4HVP4",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MNNPCPQVTSLSALLSLLQLRQSCRWPVQQGVELLALCGERGRELMLNLQPAFQPSGLYQ\nRLLSRRAQQLEIYDGCYLCLNHDRVLSCWRQLPESAMSDKQHIAQLFSLAGIHLAD",
"mw": 13.164,
"total_mw": 13.164,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Hypersensitivity response secretion protein HrpJ",
"short_name": null,
"sequence": "MKIAPVLPGIQPPHPVAINAADEAPAPTSVAPSAAASASARMPVSPLEDSMEEVSMTFAE\r\nHVERKSKALNQRRVVAQPGGRAQQHIERIEKLDELLKLLEHPQHARLETQNQKMQTLLQH\r\nSASPGMDELLHAAGGDPARCDVLLRHTLLQAQRTQNSELATKAAQSLELLHKEKGAEVSA\r\nGLNTASAIASFSTDPTQKQVMRQLYYQTIVHLQSGNAMLDALLNSFGSAHFNQGLRTLQR\r\nALADDIASRSSSIPRRALQKILSSLQDASNISQTLTASKTLLTRLAGKLPTINFTSLELT\r\nRRLLNLSGNGAYLRDLQNLSRDVAGQHPHHQVLFLSGLVPLVYHLPLGLWRDDKSKNRQM\r\nALNLLRKVISDYAGQEPRASLTQPRTAL",
"organism": "Erwinia amylovora",
"uniprot_code": "D4HVM8",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MKIAPVLPGIQPPHPVAINAADEAPAPTSVAPSAAASASARMPVSPLEDSMEEVSMTFAE\nHVERKSKALNQRRVVAQPGGRAQQHIERIEKLDELLKLLEHPQHARLETQNQKMQTLLQH\nSASPGMDELLHAAGGDPARCDVLLRHTLLQAQRTQNSELATKAAQSLELLHKEKGAEVSA\nGLNTASAIASFSTDPTQKQVMRQLYYQTIVHLQSGNAMLDALLNSFGSAHFNQGLRTLQR\nALADDIASRSSSIPRRALQKILSSLQDASNISQTLTASKTLLTRLAGKLPTINFTSLELT\nRRLLNLSGNGAYLRDLQNLSRDVAGQHPHHQVLFLSGLVPLVYHLPLGLWRDDKSKNRQM\nALNLLRKVISDYAGQEPRASLTQPRTAL",
"mw": 42.4,
"total_mw": 42.4,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20mM Tris-Cl, pH 8.0, 100mM NaCl, 2mM DTT, 0.5mM EDTA",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "HrpG/HrpV/HrpJ gatekeeper complex from Erwinia amylovora",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Greece",
"full_name": "Institute of Molecular Biology and Biotechnology, FORTH",
"webpage": "https://www.imbb.forth.gr"
}
],
"contributor_name": "Efstratios",
"contributor_surname": "Mylonas",
"orcid": "https://orcid.org/0000-0003-4476-3010"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-04-03",
"storage_temperature": 4.0,
"cell_temperature": 15.0,
"exposure_time": 0.5,
"number_of_frames": 30,
"wavelength": 0.1033,
"sample_detector_distance": 3.1,
"concentration_min": null,
"concentration_max": 1.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.216,
"s_max": 4.918,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEM4_fit1_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEM4_fit1_model1.pdb",
"model_mw": 74.61,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "CORAL model with reconstructed polypetide chain.",
"user": 370
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/HrpG_HrpV_HrpJ_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 6.615184,
"p_value": 0.0,
"fit_residual_plot": "fit4columns1724_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEM4_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 74.7,
"experimental_mw_error": null,
"guinier_i0_mw": 75.0,
"guinier_i0_mw_error": null,
"porod_mw": 78.0,
"porod_mw_error": null,
"pddf_i0": 0.2855,
"pddf_i0_error": null,
"guinier_i0": 0.272,
"guinier_i0_error": null,
"pddf_rg": 4.36,
"pddf_rg_error": null,
"guinier_rg": 4.0,
"guinier_rg_error": 0.2,
"pddf_dmax": 16.0,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": null,
"guinier_point_last": null,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDEM4_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
