The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Open the original SASBDB entry
Buffer and Sample Properties
Acquisition Conditions and Instrument
Original SASBDB Plots Experimental I(q) Experimental I(q), log-log Guinier plot Kratky plot Downloadable Files
curve：source record {
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/SASDEM7.dat",
"role": "curve",
"sha256": "ffcc107dec3bcacfb332e30fa52011e35c956b752e2d5fa5608528cc4b98bbb5",
"size": 47705,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDEM7.dat"
} full_entry_zip：source record and ZIP contents (1 items) {
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/SASDEM7.zip",
"role": "full_entry_zip",
"sha256": "48f25bc0d2bf1daef153bb3c5e514de0a0cbd7beb75df0c10165a863814b9fd0",
"size": 15036,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDEM7.zip",
"zip_member_count": 1,
"zip_members": [
{
"crc32": "25cd4684",
"name": "SASDEM7/experimental_data/SASDEM7.dat",
"size": 47705
}
],
"zip_validation": "central_directory_readable"
} pddf：source record {
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/SASDEM7.out",
"role": "pddf",
"status": "not_listed"
} sascif：source record {
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/SASDEM7.sascif",
"role": "sascif",
"sha256": "06cb4a911c7cb16384c04dc3d59913b6d797083e2eec022fc9773957565df4cc",
"size": 62423,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEM7.sascif"
} summary：source record {
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/summary.json",
"sha256": "247720ce2258666a90107c6f0a7155a60f935acc4134c5e4ac3adc8e2e103637",
"size": 7343,
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEM7/"
} All source fields (unfiltered)
Every source field is expanded here, including empty values, list members and fields already shown above.
summary.json：129 field values manifest.json：33 field values View the complete summary.json source {
"code": "SASDEM7",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Glycine decarboxylase (P-protein of glycine cleavage system)",
"publication": null,
"status": "released",
"submitted_date": "2018-11-07",
"released_date": "2021-09-20"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEM7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEM7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEM7_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEM7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEM7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Glycine decarboxylase",
"short_name": "GLDC",
"sequence": "MAAAGASRLLERLLPRHDDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATLHAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYTGVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQSGSLACCATDLLALCILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSEGLKRAGHQLQHDLFFDTLKIQCGCSVKEVLGRAAQRQINFRLFEDGTLGISLDETVNEKDLDDLLWIFGCESSAELVAESMGEECRGIPGSVFKRTSPFLTHQVFNSYHSETNIVRYMKKLENKDISLVHSMIPLGSCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASSGHHHHHH",
"organism": "Homo sapiens",
"uniprot_code": "P23378",
"uniprot_range_first": 45,
"uniprot_range_last": 1020,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MQSCARAWGLRLGRGVGGGRRLAGGSGPCWAPRSRDSSSGGGDSAAAGASRLLERLLPRH\nDDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATL\nHAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQ\nTMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYT\nGVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQSGSLACCATDLLALC\nILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEV\nYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSE\nGLKRAGHQLQHDLFFDTLKIQCGCSVKEVLGRAAQRQINFRLFEDGTLGISLDETVNEKD\nLDDLLWIFGCESSAELVAESMGEECRGIPGSVFKRTSPFLTHQVFNSYHSETNIVRYMKK\nLENKDISLVHSMIPLGSCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEK\nDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHM\nAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQH\nGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFL\nPNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYM\nAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVA\nGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHW\nDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS",
"mw": 109.367,
"total_mw": 218.734,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10 mM TRIS pH 7.5, 100 mM NaCl, 1 mM DTT , 100 mM glycine",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Human glycine decarboxylase with glycine",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ESRF",
"address": "Grenoble, France",
"full_name": "European Synchrotron Radiation Facility",
"webpage": "http://www.esrf.eu/"
}
],
"contributor_name": "Bart",
"contributor_surname": "Van Laer",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-11-12",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.5,
"number_of_frames": 10,
"wavelength": 0.099,
"sample_detector_distance": 2.864,
"concentration_min": null,
"concentration_max": 5.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.09,
"s_max": 4.934,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of human glycine decarboxylase in 10 mM TRIS pH 7.5, 100 mM NaCl, 1 mM DTT , 100 mM glycine, were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 5.00 mg/ml was measured at 20°C. 10 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 197.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 138.06,
"guinier_i0_error": 0.1,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 3.96,
"guinier_rg_error": 0.01,
"pddf_dmax": null,
"pddf_dmax_error": null,
"porod_volume": 315.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 5,
"guinier_point_last": 51,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDEM7_datloglog_img.png",
"symmetry": null,
"last_modified": "2021-09-20T13:41:56.116777+02:00",
"bragg_peak": []
} View the complete manifest.json source {
"code": "SASDEM7",
"status": "success",
"started_at": "2026-08-11T15:33:31.571825+00:00",
"finished_at": "2026-08-11T15:33:37.903560+00:00",
"source_last_modified": "2021-09-20T13:41:56.116777+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEM7/",
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/summary.json",
"size": 7343,
"sha256": "247720ce2258666a90107c6f0a7155a60f935acc4134c5e4ac3adc8e2e103637"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDEM7.dat",
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/SASDEM7.dat",
"size": 47705,
"sha256": "ffcc107dec3bcacfb332e30fa52011e35c956b752e2d5fa5608528cc4b98bbb5",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/SASDEM7.out"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEM7.sascif",
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/SASDEM7.sascif",
"size": 62423,
"sha256": "06cb4a911c7cb16384c04dc3d59913b6d797083e2eec022fc9773957565df4cc",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDEM7.zip",
"path": "/data/saxsdb/sasbdb/entries/m7/sasdem7/source/SASDEM7.zip",
"size": 15036,
"sha256": "48f25bc0d2bf1daef153bb3c5e514de0a0cbd7beb75df0c10165a863814b9fd0",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
} 
