The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDEX5",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Solution structures of long-acting insulin analogues and their complexes with albumin.",
"publication": {
"title": "Solution structures of long-acting insulin analogues and their complexes with albumin.",
"author_list": "Ryberg LA, Sønderby P, Barrientos F, Bukrinski JT, Peters GHJ, Harris P",
"journal": "Acta Crystallogr D Struct Biol",
"doi": "10.1107/S2059798318017552",
"pmid": "30950398",
"published_date": "2019 Mar 1"
},
"status": "released",
"submitted_date": "2018-10-03",
"released_date": "2019-04-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEX5.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEX5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEX5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEX5_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEX5_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEX5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEX5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "MAX IV",
"city": "Lund",
"country": "Sweden",
"beamline_name": "I911-4",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Insulin detemir (Levemir(R), Novo Nordisk A/S)",
"short_name": null,
"sequence": "GIVEQCCTSICSLYQLENYCN\r\nFVNQHLCGSHLVEALYLVCGERGFFYTPK",
"organism": null,
"uniprot_code": "P01308",
"uniprot_range_first": 25,
"uniprot_range_last": 110,
"oligomerization": "hexamer",
"molecular_type": "protein",
"uniprot_sequence": "MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED\nLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN",
"mw": 5.9,
"total_mw": 35.4,
"number_molecules": 6,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Human Albumin (Recombumin(R) Alpha, Albumedix Ltd.)",
"short_name": null,
"sequence": "DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAE\r\nNCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEV\r\nDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLP\r\nKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTK\r\nVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA\r\nDLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKC\r\nCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVST\r\nPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTES\r\nLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT\r\nKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL",
"organism": null,
"uniprot_code": "P02768",
"uniprot_range_first": 25,
"uniprot_range_last": 609,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPF\nEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEP\nERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLF\nFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAV\nARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLK\nECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYAR\nRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFE\nQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVV\nLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTL\nSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLV\nAASQAALGL",
"mw": 66.472,
"total_mw": 66.472,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "6.9 mM Na2HPO4, 11.9 mM m-cresol, 13.7 mM phenol, 157.3 mM glycerol, 38.5 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Albumin-insulin detemir 1:6 complex, binding in Südlow's Site I",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Lyngby, Denmark",
"full_name": "Technical University of Denmark",
"webpage": "http://www.dtu.dk"
}
],
"contributor_name": "Line Abildgaard",
"contributor_surname": "Ryberg",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-09-25",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 30.0,
"number_of_frames": 4,
"wavelength": 0.091,
"sample_detector_distance": 1.962,
"concentration_min": null,
"concentration_max": 8.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.085,
"s_max": 5.405,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEX5_fit2_model1_img.png",
"software": "SASREF CV",
"pdb_link": [
{
"pdb_code": "1bj5",
"ext_code": "1BJ5",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEX5_fit2_model1.pdb",
"model_mw": 99.12,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 329
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/1bj5-5-1_me2Mf5H_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 0.93,
"p_value": 0.000181,
"fit_residual_plot": "1bj5-5-1_me2Mf5H_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEX5_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEX5_fit3_model1_img.png",
"software": "DAMMIF",
"pdb_link": [
{
"pdb_code": "1trz",
"ext_code": "1TRZ",
"ext_type": "pdb",
"difference_with_model": "derived"
}
],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEX5_fit3_model1.pdb",
"model_mw": 95.7,
"bead_radius": 2.7,
"log": null,
"symmetry": null,
"comment": null,
"user": 329
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/HSA_hex-17_MTgpMvv_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 0.855,
"p_value": 2.2e-05,
"fit_residual_plot": "HSA_hex-17_MTgpMvv_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEX5_fit3.fir",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Albumin-insulin detemir (1:6 complex, binding in Südlow's Site I) in 6.9 mM Na2HPO4, 11.9 mM m-cresol, 13.7 mM phenol, 157.3 mM glycerol, 38.5 mM NaCl, pH 7.4 were collected on the I911-4 beam line at the MAX IV storage ring (Lund, Sweden) using a Dectris Pilatus 1M detector at a sample-detector distance of 2.0 m and at a wavelength of λ = 0.091 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 8.50 mg/ml was measured at 20°C. Four successive 30 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 102.1,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 108.2,
"porod_mw_error": null,
"pddf_i0": 0.075,
"pddf_i0_error": null,
"guinier_i0": 0.074,
"guinier_i0_error": null,
"pddf_rg": 3.64,
"pddf_rg_error": null,
"guinier_rg": 3.54,
"guinier_rg_error": null,
"pddf_dmax": 13.03,
"pddf_dmax_error": null,
"porod_volume": 162.34,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": null,
"guinier_point_last": null,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDEX5_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-11-27T11:57:23.524571+01:00",
"bragg_peak": []
}
