The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDEZ6",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "The structure and stability of the disulfide-linked γS-crystallin dimer provide insight into oxidation products associated with lens cataract formation.",
"publication": {
"title": "The structure and stability of the disulfide-linked γS-crystallin dimer provide insight into oxidation products associated with lens cataract formation.",
"author_list": "Thorn DC, Grosas AB, Mabbitt PD, Ray NJ, Jackson CJ, Carver JA",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2018.12.005",
"pmid": "30552875",
"published_date": "2018 Dec 12"
},
"status": "released",
"submitted_date": "2018-10-29",
"released_date": "2018-12-18"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDEZ6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDEZ6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEZ6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEZ6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDEZ6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDEZ6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEZ6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "multiwire",
"name": "Bruker HI-STAR",
"resolution": 0.0
},
"name": "Australian Nuclear Science and Technology Organisation/Australian Centre for Neutron Scattering",
"city": "Sydney",
"country": "Australia",
"beamline_name": "Bruker Nanostar II",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Gamma-crystallin S",
"short_name": null,
"sequence": ">sp|P22914|CRYGS_HUMAN Gamma-crystallin S OS=Homo sapiens OX=9606 GN=CRYGS PE=1 SV=4\r\nMSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMY\r\nILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIME\r\nQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE",
"organism": "Homo sapiens",
"uniprot_code": "P22914",
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMY\nILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIME\nQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE",
"mw": 21.007,
"total_mw": 42.014,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM sodium phosphate",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Gamma-crystallin S disulfide-linked dimer",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Canberra, Australia",
"full_name": "Australian National University",
"webpage": "https://www.anu.edu.au/"
}
],
"contributor_name": "Aidan",
"contributor_surname": "Grosas",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-02-23",
"storage_temperature": 4.0,
"cell_temperature": 25.0,
"exposure_time": 3600.0,
"number_of_frames": 4,
"wavelength": 0.1541,
"sample_detector_distance": 0.73,
"concentration_min": null,
"concentration_max": 6.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.135,
"s_max": 3.91,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEZ6_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEZ6_fit1_model1.pdb",
"model_mw": 31.045,
"bead_radius": 2.25,
"log": null,
"symmetry": null,
"comment": null,
"user": 383
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/dimer_finalP2_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.356,
"p_value": 0.648769,
"fit_residual_plot": "dimer_finalP2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEZ6_fit1.fir",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDEZ6_fit2_model1_img.png",
"software": "Chimera",
"pdb_link": [
{
"pdb_code": "6fd8",
"ext_code": "6FD8",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDEZ6_fit2_model1.pdb",
"model_mw": 41.08,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 383
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/Crys_dimer01_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 4.792,
"p_value": 0.0,
"fit_residual_plot": "fit4columns1874_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDEZ6_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of gamma-crystallin S, disulfide-linked dimer, in 20 mM sodium phosphate, pH 7 were collected on the Bruker Nanostar II instrument at the Australian Nuclear Science and Technology Organisation/Australian Centre for Neutron Scattering (ANSTO/ACNS, Sydney, Australia) using a multiwire Bruker Hi-Star detector at a sample-detector distance of 0.7 m and at a wavelength of λ = 0.1541 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 6.00 mg/ml was measured at 25°C. Four successive 3600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 36.0,
"experimental_mw_error": null,
"guinier_i0_mw": 36.0,
"guinier_i0_mw_error": 3.6,
"porod_mw": 28.0,
"porod_mw_error": null,
"pddf_i0": 557.7,
"pddf_i0_error": 1.0,
"guinier_i0": 549.21,
"guinier_i0_error": 2.0,
"pddf_rg": 2.44,
"pddf_rg_error": null,
"guinier_rg": 2.352,
"guinier_rg_error": 0.013,
"pddf_dmax": 7.5,
"pddf_dmax_error": null,
"porod_volume": 45.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 5,
"guinier_point_last": 49,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDEZ6_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDEZ6",
"status": "success",
"started_at": "2026-08-11T15:19:25.679905+00:00",
"finished_at": "2026-08-11T15:19:34.581801+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDEZ6/",
"path": "/data/saxsdb/sasbdb/entries/z6/sasdez6/source/summary.json",
"size": 8781,
"sha256": "39e4cfaf76344e0ffa0df1ba0e24b90ba4994d82dec63618b967d71ef30a448c"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDEZ6.dat",
"path": "/data/saxsdb/sasbdb/entries/z6/sasdez6/source/SASDEZ6.dat",
"size": 27217,
"sha256": "3b6efbcccd0f3245d22d08537c370c212e3b8f29050af25cd118569750479c23",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDEZ6.out",
"path": "/data/saxsdb/sasbdb/entries/z6/sasdez6/source/SASDEZ6.out",
"size": 26317,
"sha256": "042a91cd66a7caeb89de020feaa28d4a9957e9ba255e486db3d4dd04a0881b1b",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDEZ6.sascif",
"path": "/data/saxsdb/sasbdb/entries/z6/sasdez6/source/SASDEZ6.sascif",
"size": 487350,
"sha256": "7084320eb9782909e8b4c6494874722f3a0b16951a126576aa32b26e6a6296fb",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDEZ6.zip",
"path": "/data/saxsdb/sasbdb/entries/z6/sasdez6/source/SASDEZ6.zip",
"size": 92686,
"sha256": "dc1a7b3677d741b3b1f9354bcb83dfac854029ec5bcff85e70d97539940f7e08",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
