Myotilin immunoglobulin domains Ig1Ig2 (250-444)

{
  "code": "SASDF38",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Molecular basis of F-actin regulation and sarcomere assembly via myotilin",
    "publication": {
      "title": "Molecular basis of F-actin regulation and sarcomere assembly via myotilin",
      "author_list": "Kostan J, Pavšič M, Puž V, Schwarz T, Drepper F, Molt S, Graewert M, Schreiner C, Sajko S, van der Ven P, Onipe A, Svergun D, Warscheid B, Konrat R, Fürst D, Lenarčič B, Djinović-Carugo K, Machesky L",
      "journal": "PLOS Biology",
      "doi": "10.1371/journal.pbio.3001148",
      "pmid": null,
      "published_date": "2021 Apr 12"
    },
    "status": "released",
    "submitted_date": "2019-06-28",
    "released_date": "2020-10-28"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDF38.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDF38.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF38_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF38_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDF38_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF38_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF38.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Myotilin Ig1Ig2 (250-444)",
          "short_name": "Ig1Ig2 (250-444)",
          "sequence": "GPAMPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARP",
          "organism": "Homo sapiens",
          "uniprot_code": "Q9UBF9",
          "uniprot_range_first": 250,
          "uniprot_range_last": 444,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSS\nHITMSSSAFPASPKQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNY\nQQSSAGQPINAKPSQTANAKPIPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLT\nYEEKMARRLLGPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQ\nDAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIV\nSEKGLHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKV\nLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGW\nYTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPE\nGEFQRLAAQSGLYESEEL",
          "mw": 22.279,
          "total_mw": 22.279,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Na+-HEPES, 150 mM, NaCl, 5 % v/v glycerol, 1 mM DTT",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Myotilin immunoglobulin domains Ig1Ig2 (250-444)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "EMBL-Hamburg",
            "address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
            "full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
            "webpage": "http://www.embl-hamburg.de/index.php"
          }
        ],
        "contributor_name": "Melissa ",
        "contributor_surname": "Graewert",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2019-06-27",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 0.0,
    "number_of_frames": 0,
    "wavelength": 0.099,
    "sample_detector_distance": 2.867,
    "concentration_min": null,
    "concentration_max": 14.12,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.032,
    "s_max": 4.967,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of Myotilin Ig1Ig2 (250-444) in 20 mM Na+-HEPES, 150 mM, NaCl, 5 % v/v glycerol, 1 mM DTT, pH 7.4 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 14.12 mg/ml was measured at 20°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 17.3,
  "experimental_mw_error": null,
  "guinier_i0_mw": 17.3,
  "guinier_i0_mw_error": null,
  "porod_mw": 18.0,
  "porod_mw_error": null,
  "pddf_i0": 17.3,
  "pddf_i0_error": null,
  "guinier_i0": 17.3,
  "guinier_i0_error": 0.02,
  "pddf_rg": 2.913,
  "pddf_rg_error": null,
  "guinier_rg": 2.82,
  "guinier_rg_error": 0.03,
  "pddf_dmax": 10.1,
  "pddf_dmax_error": null,
  "porod_volume": 29.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 36,
  "guinier_point_last": 80,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDF38_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-10-28T14:25:01.500647+01:00",
  "bragg_peak": []
}

{
  "code": "SASDF38",
  "status": "success",
  "started_at": "2026-08-11T15:44:51.664054+00:00",
  "finished_at": "2026-08-11T15:45:00.323623+00:00",
  "source_last_modified": "2020-10-28T14:25:01.500647+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDF38/",
      "path": "/data/saxsdb/sasbdb/entries/38/sasdf38/source/summary.json",
      "size": 6711,
      "sha256": "d77ad8fb2256ee165e8410c89217a741c59ab5298b1de3886bfd14f5210ce0ed"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDF38.dat",
      "path": "/data/saxsdb/sasbdb/entries/38/sasdf38/source/SASDF38.dat",
      "size": 47740,
      "sha256": "f0408dbb819ed3bed1e1da08d020124b0265252b24bac13d8b58bcf664cd74db",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDF38.out",
      "path": "/data/saxsdb/sasbdb/entries/38/sasdf38/source/SASDF38.out",
      "size": 54714,
      "sha256": "8926de1730f8882d9422737b6ae6c3f1828cb0c942dcd44200da038e8083da12",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF38.sascif",
      "path": "/data/saxsdb/sasbdb/entries/38/sasdf38/source/SASDF38.sascif",
      "size": 96232,
      "sha256": "8dab471cec9fb98e856d5412ad17e8c0ef7b7ec3ec868393d4b6cdf531c52513",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDF38.zip",
      "path": "/data/saxsdb/sasbdb/entries/38/sasdf38/source/SASDF38.zip",
      "size": 28261,
      "sha256": "e3c94d46ce5a14d9e9c47908ffb2ac04a849164f333d882a4be5fc3e884b58b3",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}