The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDF39",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Staufen1 reads out structure and sequence features in ARF1 dsRNA for target recognition.",
"publication": {
"title": "Staufen1 reads out structure and sequence features in ARF1 dsRNA for target recognition.",
"author_list": "Yadav DK, Zigáčková D, Zlobina M, Klumpler T, Beaumont C, Kubíčková M, Vaňáčová Š, Lukavsky PJ",
"journal": "Nucleic Acids Res",
"doi": "10.1093/nar/gkz1163",
"pmid": "31875226",
"published_date": "2019 Dec 25"
},
"status": "released",
"submitted_date": "2019-07-08",
"released_date": "2019-11-29"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDF39.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDF39.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF39_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF39_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDF39_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF39_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF39.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 100K",
"resolution": 172.0
},
"name": "CEITEC",
"city": "Brno",
"country": "Czech Republic",
"beamline_name": "Rigaku BioSAXS-1000",
"beam_geometry": "",
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "ADP-ribosylation factor1 - short",
"short_name": "ARF1 RNA - short",
"sequence": "GGCAGAAGCUGCCUCUUCGGAGGCAGUUUCUGCC",
"organism": "Homo sapiens",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "RNA",
"uniprot_sequence": null,
"mw": 10.962,
"total_mw": 10.962,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Double-stranded RNA-binding protein Staufen homolog 1 - RNA binding domain 3 and 4",
"short_name": "STAU1-RBD34",
"sequence": "GSHMKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFK",
"organism": "Homo sapiens",
"uniprot_code": "O95793",
"uniprot_range_first": 183,
"uniprot_range_last": 355,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSAS\nITSTSAAAESITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPF\nPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN\nLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKN\nAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKE\nKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQ\nPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM\nVPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGH\nVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVES\nCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC",
"mw": 19.733,
"total_mw": 19.733,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM sodium phosphate buffer, 300 mM NaCl, 500 mM imidazole",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Double-stranded RNA-binding protein Staufen homolog 1 - RNA binding domain 3 and 4 - in complex with STAU1 binding site within the ADP-ribosylation factor1",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "CEITEC - Central European Institute of Technology, Masaryk University",
"webpage": "https://www.ceitec.eu/"
}
],
"contributor_name": "Tomas",
"contributor_surname": "Klumpler",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-05-29",
"storage_temperature": 20.0,
"cell_temperature": 35.0,
"exposure_time": 600.0,
"number_of_frames": 6,
"wavelength": 0.154,
"sample_detector_distance": 0.48,
"concentration_min": null,
"concentration_max": 3.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.167,
"s_max": 3.004,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDF39_fit1_model1_img.png",
"software": "Other",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDF39_fit1_model1.pdb",
"model_mw": 611.6,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 195
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDF39_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.244,
"p_value": 0.327758,
"fit_residual_plot": "SASDF39_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDF39_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/dsRBD34_hARF-for-deposition-2019-01-03-100.log",
"software_version": "2.8.3",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of double-stranded RNA-binding protein Staufen homolog 1 - RNA binding domain 3 and 4 - in complex with STAU1 binding site within the ADP-ribosylation factor1 in 50 mM sodium phosphate buffer, 300 mM NaCl, 500 mM imidazole, pH 8 were collected using a Rigaku BioSAXS-1000 instrument (CEITEC; Brno, Czech Republic) equipped with a Pilatus 100K detector at a sample-detector distance of 0.5 m and at a wavelength of λ = 0.154 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.00 mg/ml was measured at 35°C. Six successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 29.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 24.3,
"porod_mw_error": null,
"pddf_i0": 0.1882,
"pddf_i0_error": null,
"guinier_i0": 0.19,
"guinier_i0_error": 0.00012,
"pddf_rg": 2.03,
"pddf_rg_error": null,
"guinier_rg": 2.06,
"guinier_rg_error": 0.036,
"pddf_dmax": 6.39,
"pddf_dmax_error": null,
"porod_volume": 39.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 33,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDF39_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-02-12T18:29:36.378321+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDF39",
"status": "success",
"started_at": "2026-08-11T16:04:57.375156+00:00",
"finished_at": "2026-08-11T16:05:07.336855+00:00",
"source_last_modified": "2020-02-12T18:29:36.378321+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDF39/",
"path": "/data/saxsdb/sasbdb/entries/39/sasdf39/source/summary.json",
"size": 8788,
"sha256": "7ef0058b085cd843e0bad67fffa550489dd144429bcda9660f3b0d033bee7346"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDF39.dat",
"path": "/data/saxsdb/sasbdb/entries/39/sasdf39/source/SASDF39.dat",
"size": 6244,
"sha256": "82df61ad75d87caede69e83aba8e2e08fa1ed3b5e3dabc34614500fcc1843a38",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDF39.out",
"path": "/data/saxsdb/sasbdb/entries/39/sasdf39/source/SASDF39.out",
"size": 22506,
"sha256": "03c83460dd6c3ab4fd3a0e9530b69451e5ebed4849350962e56d1a61641c4fa2",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF39.sascif",
"path": "/data/saxsdb/sasbdb/entries/39/sasdf39/source/SASDF39.sascif",
"size": 4406052,
"sha256": "eb8d7b567b37fe391fd4673d4427810997da8923b6eb83ff5089b6e1abd6770c",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDF39.zip",
"path": "/data/saxsdb/sasbdb/entries/39/sasdf39/source/SASDF39.zip",
"size": 866232,
"sha256": "9e72f218cbd0cab3ebbcbdd5ff6183b38fb07c6abb7fb2ab78d939e35c01d664",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
