The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDF42",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Identification of binding sites on human serum albumin for somapacitan - a long-acting growth hormone derivative.",
"publication": {
"title": "Identification of binding sites on human serum albumin for somapacitan - a long-acting growth hormone derivative.",
"author_list": "Johansson E, Nielsen AD, Demuth H, Wiberg C, Schjødt C, Huang T, Chen J, Jensen S, Petersen J, Thygesen P",
"journal": "Biochemistry",
"doi": "10.1021/acs.biochem.0c00019",
"pmid": "32208682",
"published_date": "2020 Mar 25"
},
"status": "released",
"submitted_date": "2019-01-28",
"released_date": "2020-03-31"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDF42.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDF42.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF42_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF42_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDF42_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF42_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF42.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 100K",
"resolution": 172.0
},
"name": "Novo Nordisk A/S",
"city": "Maaloev",
"country": "Denmark",
"beamline_name": "Rigaku BioSAXS-2000",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Human serum albumin",
"short_name": "HSA",
"sequence": "DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAE\r\nNCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEV\r\nDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLP\r\nKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTK\r\nVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPA\r\nDLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKC\r\nCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVST\r\nPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTES\r\nLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT\r\nKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL",
"organism": "Homo sapiens",
"uniprot_code": "P02768",
"uniprot_range_first": 25,
"uniprot_range_last": 609,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPF\nEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEP\nERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLF\nFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAV\nARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLK\nECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYAR\nRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFE\nQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVV\nLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTL\nSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLV\nAASQAALGL",
"mw": 66.472,
"total_mw": 66.472,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Somapacitan",
"short_name": null,
"sequence": "FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSCVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF",
"organism": "Homo sapiens",
"uniprot_code": "P01241",
"uniprot_range_first": 27,
"uniprot_range_last": 217,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA\nYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR\nSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD\nALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF",
"mw": 22.119,
"total_mw": 44.238,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "100 mM MES, 140 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.5,
"deuteration": null
},
"purity_method": null,
"name": "Human serum albumin in complex with somapacitan",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Denmark",
"full_name": "Novo Nordisk A/S",
"webpage": "https://www.novonordisk.com/"
}
],
"contributor_name": "Eva",
"contributor_surname": "Johansson",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-09-04",
"storage_temperature": null,
"cell_temperature": 25.0,
"exposure_time": 3600.0,
"number_of_frames": 6,
"wavelength": 0.1542,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": 6.3,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.037,
"s_max": 6.45,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDF42_fit1_model1_img.png",
"software": "SASREF",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDF42_fit1_model1.pdb",
"model_mw": 108.3,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/15Anew.log",
"symmetry": null,
"comment": null,
"user": 408
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDF42_fit1_fixed_fit_img.png",
"software": "SASREF",
"chi_square_value": 2.1025,
"p_value": 0.002492,
"fit_residual_plot": "SASDF42_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDF42_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.5a",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of HSA in complex with somapacitan in 100 mM MES, 140 mM NaCl, pH 6.5 were collected on a Rigaku BioSAXS-2000 instrument at Novo Nordisk A/S (Maaloev, Denmark) using a Pilatus 100K detector at a wavelength of λ = 0.1542 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 6.30 mg/ml was measured at 25°C. Six successive 3600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 113.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 126.0,
"porod_mw_error": null,
"pddf_i0": 6.834,
"pddf_i0_error": null,
"guinier_i0": 6.843,
"guinier_i0_error": 0.02,
"pddf_rg": 4.12,
"pddf_rg_error": null,
"guinier_rg": 4.06,
"guinier_rg_error": 0.02,
"pddf_dmax": 13.92,
"pddf_dmax_error": null,
"porod_volume": 202.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 6,
"guinier_point_last": 20,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDF42_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-11-27T12:03:56.572790+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDF42",
"status": "success",
"started_at": "2026-08-11T13:29:59.790861+00:00",
"finished_at": "2026-08-11T13:30:10.037269+00:00",
"source_last_modified": "2020-11-27T12:03:56.572790+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDF42/",
"path": "/data/saxsdb/sasbdb/entries/42/sasdf42/source/summary.json",
"size": 9160,
"sha256": "57f56c562c723ea3c0186085b50853ca92b9f6a3bc29df2be2de77bbfd848a0e"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDF42.dat",
"path": "/data/saxsdb/sasbdb/entries/42/sasdf42/source/SASDF42.dat",
"size": 20903,
"sha256": "d937627ec9f2811faafadd7dc1dd9589fe4454ac90a04a6bc8d48bdba4974de8",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDF42.out",
"path": "/data/saxsdb/sasbdb/entries/42/sasdf42/source/SASDF42.out",
"size": 16739,
"sha256": "aad1d851cfb04b9cc0e716dfe029feeb7d256529ed1b08c492a90dc5137768bd",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF42.sascif",
"path": "/data/saxsdb/sasbdb/entries/42/sasdf42/source/SASDF42.sascif",
"size": 853775,
"sha256": "b0588e805b46fbb0a00f54a9f84781bf7ae8598bb4b74a49115e3e025fa44491",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDF42.zip",
"path": "/data/saxsdb/sasbdb/entries/42/sasdf42/source/SASDF42.zip",
"size": 144131,
"sha256": "ebd676e580763aa116ae54a294eeccd4b6214773d40f0e97a6f04fb5101603ae",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
