Double-stranded RNA-binding protein Staufen homolog 1 - RNA binding domain 3 and 4 - in complex with STAU1 binding site within the ADP-ribosylation factor1 - long

{
  "code": "SASDF49",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Staufen1 reads out structure and sequence features in ARF1 dsRNA for target recognition.",
    "publication": {
      "title": "Staufen1 reads out structure and sequence features in ARF1 dsRNA for target recognition.",
      "author_list": "Yadav DK, Zigáčková D, Zlobina M, Klumpler T, Beaumont C, Kubíčková M, Vaňáčová Š, Lukavsky PJ",
      "journal": "Nucleic Acids Res",
      "doi": "10.1093/nar/gkz1163",
      "pmid": "31875226",
      "published_date": "2019 Dec 25"
    },
    "status": "released",
    "submitted_date": "2019-07-08",
    "released_date": "2019-11-29"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDF49.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDF49.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF49_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF49_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDF49_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF49_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF49.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": "1 x 5 mm",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Double-stranded RNA-binding protein Staufen homolog 1 - RNA binding domain 3 and 4",
          "short_name": "STAU1-RBD34",
          "sequence": "GSHMKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFK",
          "organism": "Homo sapiens",
          "uniprot_code": "O95793",
          "uniprot_range_first": 183,
          "uniprot_range_last": 355,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSAS\nITSTSAAAESITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPF\nPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN\nLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKN\nAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKE\nKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQ\nPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM\nVPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGH\nVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVES\nCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC",
          "mw": 19.733,
          "total_mw": 19.733,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "ADP-ribosylation factor1 - long",
          "short_name": "ARF1 RNA - long",
          "sequence": "GGCGAGUGCCAGAAGCUGUCUCCUUCGGGAGGCAGUUUCUGGUACUCGCC",
          "organism": "Homo sapiens",
          "uniprot_code": null,
          "uniprot_range_first": null,
          "uniprot_range_last": null,
          "oligomerization": "monomer",
          "molecular_type": "RNA",
          "uniprot_sequence": null,
          "mw": 16.137,
          "total_mw": 16.137,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM potassium phosphate, 100 mM NaCl, 3.5 mM 2-mercaptoethanol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.8,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Double-stranded RNA-binding protein Staufen homolog 1 - RNA binding domain 3 and 4 - in complex with STAU1 binding site within the ADP-ribosylation factor1 - long",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "CEITEC - Central European Institute of Technology, Masaryk University",
            "webpage": "https://www.ceitec.eu/"
          }
        ],
        "contributor_name": "Tomas",
        "contributor_surname": "Klumpler",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-09-20",
    "storage_temperature": null,
    "cell_temperature": 15.0,
    "exposure_time": 3.0,
    "number_of_frames": 1,
    "wavelength": 0.1025,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": 5.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.206,
    "s_max": 3.001,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of double-stranded RNA-binding protein Staufen homolog 1 - RNA binding domain 3 and 4 - in complex with STAU1 binding site within the ADP-ribosylation factor1 - long in 50 mM potassium phosphate, 100 mM NaCl, 3.5 mM 2-mercaptoethanol, pH 6.8 were collected on the B21 beam line at the Diamond Light Source (Didcot, UK) using a Pilatus 2M detector at a wavelength of λ = 0.1025 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 5.00 mg/ml was measured at 15°C. One 3 second frame was collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 34.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 33.0,
  "porod_mw_error": null,
  "pddf_i0": 0.009973,
  "pddf_i0_error": null,
  "guinier_i0": 0.01024,
  "guinier_i0_error": 7.8e-05,
  "pddf_rg": 2.46,
  "pddf_rg_error": null,
  "guinier_rg": 2.536,
  "guinier_rg_error": 0.063,
  "pddf_dmax": 6.97,
  "pddf_dmax_error": null,
  "porod_volume": 53.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 28,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDF49_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-02-12T18:29:36.587247+01:00",
  "bragg_peak": []
}

{
  "code": "SASDF49",
  "status": "success",
  "started_at": "2026-08-11T16:05:39.670030+00:00",
  "finished_at": "2026-08-11T16:05:46.771856+00:00",
  "source_last_modified": "2020-02-12T18:29:36.587247+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDF49/",
      "path": "/data/saxsdb/sasbdb/entries/49/sasdf49/source/summary.json",
      "size": 7643,
      "sha256": "7e25e6d74aa0cc60d16a25b2f8b6a2469decb1562996161e28d0e01c4751750b"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDF49.dat",
      "path": "/data/saxsdb/sasbdb/entries/49/sasdf49/source/SASDF49.dat",
      "size": 11494,
      "sha256": "f149637abdcba17828907ceb3ab7545c43cc8dc18af7ee3d473f4306a0bd7874",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDF49.out",
      "path": "/data/saxsdb/sasbdb/entries/49/sasdf49/source/SASDF49.out",
      "size": 27814,
      "sha256": "9a5e0c939855d3c4877153b451040894e4e061455609626f3aee42619b0768f4",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF49.sascif",
      "path": "/data/saxsdb/sasbdb/entries/49/sasdf49/source/SASDF49.sascif",
      "size": 37624,
      "sha256": "85e8ba8a36be21f07d21564da38c603b1d2921dbc88f20b66c1efbe253330f67",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDF49.zip",
      "path": "/data/saxsdb/sasbdb/entries/49/sasdf49/source/SASDF49.zip",
      "size": 11847,
      "sha256": "6471fea14d094dce144c37a3a1d8538ffa36825bf344721be47c1791f322ad3e",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}