The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDF62",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Structure, dynamics and roX2-lncRNA binding of tandem double-stranded RNA binding domains dsRBD1,2 of Drosophila helicase Maleless.",
"publication": {
"title": "Structure, dynamics and roX2-lncRNA binding of tandem double-stranded RNA binding domains dsRBD1,2 of Drosophila helicase Maleless.",
"author_list": "Ankush Jagtap PK, Müller M, Masiewicz P, von Bülow S, Hollmann NM, Chen PC, Simon B, Thomae AW, Becker PB, Hennig J",
"journal": "Nucleic Acids Res",
"doi": "10.1093/nar/gkz125",
"pmid": "30805612",
"published_date": "2019 May 7"
},
"status": "released",
"submitted_date": "2019-01-28",
"released_date": "2019-02-21"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDF62.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDF62.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF62_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF62_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDF62_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF62_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF62.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Dosage compensation regulator",
"short_name": "MLE",
"sequence": "> dsRBD12_single | chain A | 259 aa\r\nGAMDIKSFLYQFCAKSQIEPKFDIRQTGPKNRQRFLCEVRVEPNTYIGVGNSTNKKDAEK\r\nNACRDFVNYLVRVGKLNTNDVPADAGASGGGPRTGLEGAGMAGGSGQQKRVFDGQSGPQD\r\nLGEAYRPLNHDGGDGGNRYSVIDRIQEQRDMNEAEAFDVNAAIHGNWTIENAKERLNIYK\r\nQTNNIRDDYKYTPVGPEHARSFLAELSIYVPALNRTVTARESGSNKKSASKSCALSLVRQ\r\nLFHLNVIEPFSGTLKKKKD",
"organism": "Drosophila melanogaster",
"uniprot_code": "P24785",
"uniprot_range_first": 1,
"uniprot_range_last": 257,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MDIKSFLYQFCAKSQIEPKFDIRQTGPKNRQRFLCEVRVEPNTYIGVGNSTNKKDAEKNA\nCRDFVNYLVRVGKLNTNDVPADAGASGGGPRTGLEGAGMAGGSGQQKRVFDGQSGPQDLG\nEAYRPLNHDGGDGGNRYSVIDRIQEQRDMNEAEAFDVNAAIHGNWTIENAKERLNIYKQT\nNNIRDDYKYTPVGPEHARSFLAELSIYVPALNRTVTARESGSNKKSASKSCALSLVRQLF\nHLNVIEPFSGTLKKKKDEQLKPYPVKLSPNLINKIDEVIKGLDLPVVNPRNIKIELDGPP\nIPLIVNLSRIDSSQQDGEKRQESSVIPWAPPQANWNTWHACNIDEGELATTSIDDLSMDY\nERSLRDRRQNDNEYRQFLEFREKLPIAAMRSEILTAINDNPVVIIRGNTGCGKTTQIAQY\nILDDYICSGQGGYANIYVTQPRRISAISVAERVARERCEQLGDTVGYSVRFESVFPRPYG\nAILFCTVGVLLRKLEAGLRGVSHIIVDEIHERDVNSDFLLVILRDMVDTYPDLHVILMSA\nTIDTTKFSKYFGICPVLEVPGRAFPVQQFFLEDIIQMTDFVPSAESRRKRKEVEDEEQLL\nSEDKDEAEINYNKVCEDKYSQKTRNAMAMLSESDVSFELLEALLMHIKSKNIPGAILVFL\nPGWNLIFALMKFLQNTNIFGDTSQYQILPCHSQIPRDEQRKVFEPVPEGVTKIILSTNIA\nETSITIDDIVFVIDICKARMKLFTSHNNLTSYATVWASKTNLEQRKGRAGRVRPGFCFTL\nCSRARFQALEDNLTPEMFRTPLHEMALTIKLLRLGSIHHFLSKALEPPPVDAVIEAEVLL\nREMRCLDANDELTPLGRLLARLPIEPRLGKMMVLGAVFGCADLMAIMASYSSTFSEVFSL\nDIGQRRLANHQKALSGTKCSDHVAMIVASQMWRREKQRGEHMEARFCDWKGLQMSTMNVI\nWDAKQQLLDLLQQAGFPEECMISHEVDERIDGDDPVLDVSLALLCLGLYPNICVHKEKRK\nVLTTESKAALLHKTSVNCSNLAVTFPYPFFVFGEKIRTRAVSCKQLSMVSPLQVILFGSR\nKIDLAANNIVRVDNWLNFDIEPELAAKIGALKPALEDLITVACDNPSDILRLEEPYAQLV\nKVVKDLCVKSAGDFGLQRESGILPHQSRQFSDGGGPPKRGRFETGRFTNSSFGRRGNGRT\nFGGGYGNNGGGYGNNGGGYGNIGGGYGNNAGGYGNNGGYGNNGGGYRNNGGGYGNNGGGY\nGNKRGGFGDSFESNRGSGGGFRNGDQGGRWGNF",
"mw": 28.549,
"total_mw": 28.549,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "roX2 stem-loop 7, 18-mer fragment",
"short_name": "SL7-18mer",
"sequence": "> 5' sequence followed by 3' sequence\r\nAGACGUGUAAAAUGUUGC\r\nUCCGCGCAUUUUGCAAUG",
"organism": "synthetic construct",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "monomer",
"molecular_type": "RNA",
"uniprot_sequence": null,
"mw": 11.592,
"total_mw": 11.592,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM NaPO4, 200 mM NaCl, 1 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.5,
"deuteration": null
},
"purity_method": null,
"name": "Mixture of the dsRBD1 and dsRBD2 domains of Drosophila helicase dosage compensation regulator, MLE, and the roX2 RNA stem-loop 7 18mer-fragment, at 1.0 mg/ml",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL",
"address": "Heidelberg, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Heidelberg",
"webpage": "https://www.embl.de/"
}
],
"contributor_name": "Po-chia",
"contributor_surname": "Chen",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-11-29",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 10,
"wavelength": 0.09919,
"sample_detector_distance": 2.867,
"concentration_min": null,
"concentration_max": 1.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.035,
"s_max": 4.944,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of the dsRBD1 and dsRBD2 domains of Drosophila helicase dosage compensation regulator, MLE, and the roX2 RNA stem-loop 7 18mer-fragment in 20 mM NaPO4, 200 mM NaCl, 1 mM DTT, pH 6.5 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus 1M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.09919 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 1.00 mg/ml was measured at 20°C. 10 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 7.3,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 41.25,
"pddf_i0_error": null,
"guinier_i0": 40.73,
"guinier_i0_error": 0.084,
"pddf_rg": 3.34,
"pddf_rg_error": null,
"guinier_rg": 3.11,
"guinier_rg_error": 0.31,
"pddf_dmax": 13.3,
"pddf_dmax_error": null,
"porod_volume": 25.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 14,
"guinier_point_last": 73,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDF62_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDF62",
"status": "success",
"started_at": "2026-08-11T13:31:19.978018+00:00",
"finished_at": "2026-08-11T13:31:27.938857+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDF62/",
"path": "/data/saxsdb/sasbdb/entries/62/sasdf62/source/summary.json",
"size": 8537,
"sha256": "5f3d1bbcd53d4e7864c63cc3e707074dad0303c40a14a17ac881584bfefc1378"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDF62.dat",
"path": "/data/saxsdb/sasbdb/entries/62/sasdf62/source/SASDF62.dat",
"size": 35050,
"sha256": "fc9eebe50f674ef2c85becac5f33b403d784d1ff20ba963c545515efa338c4fa",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDF62.out",
"path": "/data/saxsdb/sasbdb/entries/62/sasdf62/source/SASDF62.out",
"size": 44306,
"sha256": "c4e3e6e774f5959c4205ecf59141953f6a5dcc48d20e06eb223b3b3e7da87a47",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF62.sascif",
"path": "/data/saxsdb/sasbdb/entries/62/sasdf62/source/SASDF62.sascif",
"size": 94175,
"sha256": "403ef6c9c99065565ba5200c912a00ac9b9b4bfad459099fcb7768f71ff33d36",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDF62.zip",
"path": "/data/saxsdb/sasbdb/entries/62/sasdf62/source/SASDF62.zip",
"size": 27815,
"sha256": "f0478fa2e1615a76e36c5c12d7f4648e41064d865500e52017f3d90fdf5f7bac",
"role": "full_entry_zip",
"zip_member_count": 2,
"zip_validation": "central_directory_readable"
}
]
}
