Delta subunit of RNA polymerase, RNAP (B. subtilis), 800 mM NaCl

{
  "code": "SASDF88",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Quantitative Conformational Analysis of Functionally Important Electrostatic Interactions in the Intrinsically Disordered Region of Delta Subunit of Bacterial RNA Polymerase.",
    "publication": {
      "title": "Quantitative Conformational Analysis of Functionally Important Electrostatic Interactions in the Intrinsically Disordered Region of Delta Subunit of Bacterial RNA Polymerase.",
      "author_list": "Kuban V, Srb P, Stegnerova H, Padrta P, Zachrdla M, Jasenakova Z, Šanderová H, Vítovská D, Krasny L, Koval T, Dohnalek J, Ziemska-Legi Cka J, Grynberg M, Jarnot P, Gruca A, Jensen MR, Blackledge M, Zidek L",
      "journal": "J Am Chem Soc",
      "doi": "10.1021/jacs.9b07837",
      "pmid": "31550880",
      "published_date": "2019 Sep 24"
    },
    "status": "released",
    "submitted_date": "2019-06-22",
    "released_date": "2019-09-30"
  },
  "pddf_data": null,
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDF88.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF88_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF88_kratky_img.png",
  "pddf_plot": null,
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF88_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF88.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 2M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "DNA-directed RNA polymerase subunit delta",
          "short_name": "RpoE",
          "sequence": "MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK",
          "organism": "Bacillus subtilis",
          "uniprot_code": "P12464",
          "uniprot_range_first": 1,
          "uniprot_range_last": 173,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYT\nDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDE\nDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK",
          "mw": 20.399,
          "total_mw": 20.399,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Phosphate buffer, 800 mM NaCl, 0.05% NaN3",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.6,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Delta subunit of RNA polymerase, RNAP (B. subtilis), 800 mM NaCl",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "MUNI",
            "address": "Brno, Czech Republic",
            "full_name": "Masaryk University;   \tResearch group Structure and Dynamics of Proteins.",
            "webpage": "https://www.muni.cz/"
          }
        ],
        "contributor_name": "Vojtěch",
        "contributor_surname": "Kubáň",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2016-10-03",
    "storage_temperature": 20.0,
    "cell_temperature": 20.0,
    "exposure_time": 0.05,
    "number_of_frames": 20,
    "wavelength": 0.124,
    "sample_detector_distance": 3.0,
    "concentration_min": null,
    "concentration_max": 3.6,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.013,
    "s_max": 3.788,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": null,
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of RNAP in 20 mM phosphate buffer, 800 mM NaCl, 0.05% NaN3, pH 6.6 were collected on the EMBL P12 beam line at PETRA III (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.60 mg/ml was measured at 20°C. 20 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 40.2,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 48.0,
  "porod_mw_error": null,
  "pddf_i0": null,
  "pddf_i0_error": null,
  "guinier_i0": 7411.0,
  "guinier_i0_error": 32.0,
  "pddf_rg": null,
  "pddf_rg_error": null,
  "guinier_rg": 4.49,
  "guinier_rg_error": 0.28,
  "pddf_dmax": 21.0,
  "pddf_dmax_error": null,
  "porod_volume": 77.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 34,
  "guinier_point_last": 132,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDF88_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2023-06-21T07:56:39.492710+02:00",
  "bragg_peak": []
}

{
  "code": "SASDF88",
  "status": "success",
  "started_at": "2026-08-11T15:47:45.603660+00:00",
  "finished_at": "2026-08-11T15:47:52.092507+00:00",
  "source_last_modified": "2023-06-21T07:56:39.492710+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDF88/",
      "path": "/data/saxsdb/sasbdb/entries/88/sasdf88/source/summary.json",
      "size": 6407,
      "sha256": "df4ff4da22feb9d564647bdc8e177cb37ab72490a2816d65f56396b2fd95b134"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDF88.dat",
      "path": "/data/saxsdb/sasbdb/entries/88/sasdf88/source/SASDF88.dat",
      "size": 82977,
      "sha256": "762c8db94bfe0f80bb8a65f4591fce6da613f4ac3020f61dcb6889d59d181a31",
      "role": "curve"
    },
    {
      "role": "pddf",
      "status": "not_listed",
      "path": "/data/saxsdb/sasbdb/entries/88/sasdf88/source/SASDF88.out"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF88.sascif",
      "path": "/data/saxsdb/sasbdb/entries/88/sasdf88/source/SASDF88.sascif",
      "size": 105377,
      "sha256": "7dc587b3f82e7389ae0ecb4cc35239f3b90317f588f15aa939e02eb4af11e031",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDF88.zip",
      "path": "/data/saxsdb/sasbdb/entries/88/sasdf88/source/SASDF88.zip",
      "size": 23998,
      "sha256": "863e56cb1646c2c19ddf65b1461d404073f7dea091a0a6423baf3e37d9c89356",
      "role": "full_entry_zip",
      "zip_member_count": 1,
      "zip_validation": "central_directory_readable"
    }
  ]
}