Phosphorylated Resistance to inhibitors of cholinesterase 8 homolog A, Ric-8A, amino acids 1-452 (Rattus norvegicus)

{
  "code": "SASDFB5",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "Structure, Function, and Dynamics of the Gα Binding Domain of Ric-8A.",
    "publication": {
      "title": "Structure, Function, and Dynamics of the Gα Binding Domain of Ric-8A.",
      "author_list": "Zeng B, Mou TC, Doukov TI, Steiner A, Yu W, Papasergi-Scott M, Tall GG, Hagn F, Sprang SR",
      "journal": "Structure",
      "doi": "10.1016/j.str.2019.04.013",
      "pmid": "31155309",
      "published_date": "2019 May 9"
    },
    "status": "released",
    "submitted_date": "2019-04-08",
    "released_date": "2019-06-05"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFB5.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFB5.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFB5_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFB5_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFB5_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFB5_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFB5.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Rayonix MX225-HE",
        "resolution": null
      },
      "name": "Stanford Synchrotron Radiation Lightsource (SSRL)",
      "city": "Menlo Park, CA",
      "country": "USA",
      "beamline_name": "BL4-2",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Resistance to inhibitors of cholinesterase 8 homolog A",
          "short_name": "Ric-8A",
          "sequence": "GMEPRAVADALETGEEDAVTEALRSFNREHSQSFTFDDAQQEDRKRLAKLLVSVLEQGLSPKHRVTWLQTI\r\nRILSRDRSCLDSFASRQSLHALACYADIAISEEPIPQPPDMDVLLESLKCLCNLVLSSPTAQMLAAEARL\r\nVVRLAERVGLYRKRSYPHEVQFFDLRLLFLLTALRTDVRQQLFQELHGVRLLTDALELTLGVAPKENPLV\r\nILPAQETERAMEILKVLFNITFDSVKREVDEEDAALYRYLGTLLRHCVMADAAGDRTEEFHGHTVNLLGN\r\nLPLKCLDVLLALELHEGSLEFMGVNMDVINALLAFLEKRLHQTHRLKECVAPVLSVLTECARMHRPARKF\r\nLKAQVLPPLRDVRTRPEVGDLLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLA\r\nARGLMAGGRPEGQYSEDEDTDTEEYREAKASI",
          "organism": "Rattus norvegicus",
          "uniprot_code": "B1H241",
          "uniprot_range_first": 1,
          "uniprot_range_last": 452,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MEPRAVADALETGEEDAVTEALRSFNREHSQSFTFDDAQQEDRKRLAKLLVSVLEQGLSP\nKHRVTWLQTIRILSRDRSCLDSFASRQSLHALACYADIAISEEPIPQPPDMDVLLESLKC\nLCNLVLSSPTAQMLAAEARLVVRLAERVGLYRKRSYPHEVQFFDLRLLFLLTALRTDVRQ\nQLFQELHGVRLLTDALELTLGVAPKENPLVILPAQETERAMEILKVLFNITYDSVKREVD\nEEDAALYRYLGTLLRHCVMADAAGDRTEEFHGHTVNLLGNLPLKCLDVLLALELHEGSLE\nFMGVNMDVINALLAFLEKRLHQTHRLKECVAPVLSVLTECARMHRPARKFLKAQVLPPLR\nDVRTRPEVGDLLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLA\nARGLMAGGRPEGQYSEDEDTDTEEYREAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAM\nKLVNMFDKLSRHRLIQPMGMSPRGHLTSLQDAMCETMEGQLSSDPDSDPD",
          "mw": 51.09,
          "total_mw": 51.09,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25 mM HEPES, 150 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Phosphorylated Resistance to inhibitors of cholinesterase 8 homolog A, Ric-8A, amino acids 1-452 (Rattus norvegicus)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Montana, USA",
            "full_name": "University of Montana",
            "webpage": "https://www.umt.edu/"
          }
        ],
        "contributor_name": "Tung-Chung",
        "contributor_surname": "Mou",
        "orcid": "https://orcid.org/0000-0001-6554-1519"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-04-24",
    "storage_temperature": 4.0,
    "cell_temperature": 23.0,
    "exposure_time": 1.0,
    "number_of_frames": 25,
    "wavelength": 0.1127,
    "sample_detector_distance": 1.7,
    "concentration_min": null,
    "concentration_max": 1.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.065,
    "s_max": 4.239,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of phosphorylated Ric-8A (amino acids 1-452) in 25mM HEPES, 150mM NaCl, pH 8 were collected using size-exclusion chromatography SAXS (SEC-SAXS) on the BL4-2 beam line at the Stanford Synchrotron Radiation Lightsource (SSRL; Stanford, CA, USA) using a Rayonix MX225-HE detector at a sample-detector distance of 1.7 m and at a wavelength of λ = 0.1127 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SEC-SAXS was performed at 25 °C using the following parameters: Column: Superdex 200 Increase 3.2/300 analytical SEC column; Flow rate: 0.05 mL/min; Sample injection concentration: 1.0 mg/mL; Injection volume: 100 μL. The data were collected through the SEC peak of the sample as a series of 25 x 1 second exposures. Each unsubtracted data frame was normalised to the intensity of the transmitted beam and radially averaged and the scattering of an appropriate solvent-blank was subtracted. The resulting subtracted frames were scaled and averaged to generate the final SAXS profile displayed in this entry.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 51.2,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 44.0,
  "porod_mw_error": null,
  "pddf_i0": 84.64,
  "pddf_i0_error": null,
  "guinier_i0": 84.58,
  "guinier_i0_error": 0.081,
  "pddf_rg": 3.01,
  "pddf_rg_error": null,
  "guinier_rg": 2.96,
  "guinier_rg_error": 0.02,
  "pddf_dmax": 10.1,
  "pddf_dmax_error": null,
  "porod_volume": 70.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 15,
  "guinier_point_last": 69,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDFB5_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDFB5",
  "status": "success",
  "started_at": "2026-08-11T14:43:55.132413+00:00",
  "finished_at": "2026-08-11T14:44:02.759705+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFB5/",
      "path": "/data/saxsdb/sasbdb/entries/b5/sasdfb5/source/summary.json",
      "size": 7390,
      "sha256": "1e30de80740278a12cd1095778c0eeb01d75d00639d747c8a5b3f6caf5adfad9"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDFB5.dat",
      "path": "/data/saxsdb/sasbdb/entries/b5/sasdfb5/source/SASDFB5.dat",
      "size": 37558,
      "sha256": "eca71569f6d8aec1aa3f3827db50339e956dd235df457134ae589f7adea3e8c3",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDFB5.out",
      "path": "/data/saxsdb/sasbdb/entries/b5/sasdfb5/source/SASDFB5.out",
      "size": 37574,
      "sha256": "743a876513a6734ff5ba37ee977f049873497d026e4e92556f6f5856d543b09e",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFB5.sascif",
      "path": "/data/saxsdb/sasbdb/entries/b5/sasdfb5/source/SASDFB5.sascif",
      "size": 74877,
      "sha256": "44643459300457d067fd5d7b5702955691f03683796c5edc1ea8f96b769f6e69",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDFB5.zip",
      "path": "/data/saxsdb/sasbdb/entries/b5/sasdfb5/source/SASDFB5.zip",
      "size": 21032,
      "sha256": "8d64dea69c675cd15dd1c9918bbb370b01718631d6158cb6a8fe8743a2a6f5b6",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}