The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDFC7",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Modulation of Human Phenylalanine Hydroxylase by 3-Hydroxyquinolin-2(1H)-One Derivatives",
"publication": {
"title": "Modulation of Human Phenylalanine Hydroxylase by 3-Hydroxyquinolin-2(1H)-One Derivatives",
"author_list": "Lopes R, Tomé C, Russo R, Paterna R, Leandro J, Candeias N, Gonçalves L, Teixeira M, Sousa P, Guedes R, Vicente J, Gois P, Leandro P",
"journal": "Biomolecules",
"doi": "10.3390/biom11030462",
"pmid": null,
"published_date": "2021 Mar 19"
},
"status": "released",
"submitted_date": "2019-06-06",
"released_date": "2021-03-25"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFC7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFC7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFC7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFC7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFC7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFC7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFC7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": "1 x 5 mm",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Phenylalanine-4-hydroxylase",
"short_name": "PAH",
"sequence": "MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRGAS\r\nMSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV\r\nNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW\r\nFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM\r\nEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF\r\nRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA\r\nQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE\r\nKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR\r\nIEVLDNTQQLKILADSINSEIGILCSALQKIK",
"organism": "Homo sapiens",
"uniprot_code": "P00439",
"uniprot_range_first": 1,
"uniprot_range_last": 452,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV\nNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW\nFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM\nEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF\nRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA\nQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE\nKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR\nIEVLDNTQQLKILADSINSEIGILCSALQKIK",
"mw": 55.777,
"total_mw": 223.108,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "0.02 mM Hepes, 0.2 M NaCl,",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Human phenylalanine hydroxylase (hPAH) + 1 mM L-Phe",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Oeiras, Portugal",
"full_name": "Instituto de Tecnologia Química e Biológica António Xavier, Universidade de Lisboa",
"webpage": "http://www.itqb.unl.pt"
}
],
"contributor_name": "Catarina",
"contributor_surname": "Tomé",
"orcid": "https://orcid.org/0000-0002-8456-4078"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-02-25",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 3.0,
"number_of_frames": 541,
"wavelength": 0.1,
"sample_detector_distance": 4.0,
"concentration_min": null,
"concentration_max": 12.0,
"sample_volume": 45.0,
"flow_rate": 0.16,
"s_min": 0.045,
"s_max": 4.077,
"total_exposure_time": null,
"seccolumn": 16
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFC7_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFC7_fit1_model1.pdb",
"model_mw": 160.54,
"bead_radius": 3.1,
"log": null,
"symmetry": "P222",
"comment": null,
"user": 450
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFC7_fit1_model2_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "5.0",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFC7_fit1_model2.pdb",
"model_mw": 258.12,
"bead_radius": 4.0,
"log": null,
"symmetry": "P222",
"comment": "Filtered model",
"user": 450
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDFC7_fit1_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.158,
"p_value": 0.039866,
"fit_residual_plot": "SASDFC7_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFC7_fit1.fir",
"fit_log": null,
"software_version": "5.3",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFC7_fit2_model1_img.png",
"software": "CORAL",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFC7_fit2_model1.pdb",
"model_mw": 222.3,
"bead_radius": 1.9,
"log": null,
"symmetry": "P222",
"comment": null,
"user": 450
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDFC7_fit2_fixed_fit_img.png",
"software": "CORAL",
"chi_square_value": 1.13,
"p_value": 0.083198,
"fit_residual_plot": "SASDFC7_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFC7_fit2.fit",
"fit_log": null,
"software_version": "1.1",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": null,
"experimental_mw": 224.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 229.0,
"porod_mw_error": null,
"pddf_i0": 0.01494,
"pddf_i0_error": 6e-05,
"guinier_i0": 0.015,
"guinier_i0_error": 0.0001,
"pddf_rg": 4.04,
"pddf_rg_error": 0.13,
"guinier_rg": 4.006,
"guinier_rg_error": 0.037,
"pddf_dmax": 12.3,
"pddf_dmax_error": 0.5,
"porod_volume": 367.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 34,
"guinier_point_last": 102,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDFC7_datloglog_img.png",
"symmetry": null,
"last_modified": "2021-03-25T12:57:57.411565+01:00",
"bragg_peak": []
}
