The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDFE5",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Thermodynamics, cooperativity and stability of the tetracycline repressor (TetR) upon tetracycline binding.",
"publication": {
"title": "Thermodynamics, cooperativity and stability of the tetracycline repressor (TetR) upon tetracycline binding.",
"author_list": "Palm GJ, Buchholz I, Werten S, Girbardt B, Berndt L, Delcea M, Hinrichs W",
"journal": "Biochim Biophys Acta Proteins Proteom",
"doi": "10.1016/j.bbapap.2020.140404",
"pmid": "32114262",
"published_date": "2020 Feb 27"
},
"status": "released",
"submitted_date": "2019-04-11",
"released_date": "2020-03-05"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFE5.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFE5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFE5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFE5_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFE5_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFE5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFE5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Tetracycline repressor (class D)",
"short_name": "TetR(D)",
"sequence": "SRLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPAAPDENLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQIV",
"organism": "Escherichia coli",
"uniprot_code": "P0ACT4",
"uniprot_range_first": 2,
"uniprot_range_last": 208,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEIL\nARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFM\nTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPAAPDENLPPLLREALQIMDSD\nDGEQAFLHGLESLIRGFEVQLTALLQIVGGDKLIIPFC",
"mw": 23.259,
"total_mw": 46.518,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "5a,6-anhydrotetracycline",
"short_name": "ATc",
"sequence": "C22H22N2O7",
"organism": null,
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "dimer",
"molecular_type": "other",
"uniprot_sequence": null,
"mw": 0.426,
"total_mw": 0.852,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris/HCl 150 mM NaCl 10 mM MgCl2",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Tetracycline repressor (class D), TetR(D), in complex with 5a,6-anhydrotetracycline (ATc)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Innsbruck, Austria",
"full_name": "Medical University of Innsbruck",
"webpage": "https://www.i-med.ac.at/"
}
],
"contributor_name": "Sebastiaan",
"contributor_surname": "Werten",
"orcid": "https://orcid.org/0000-0003-2244-9688"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2013-09-23",
"storage_temperature": null,
"cell_temperature": 10.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.1,
"concentration_min": 1.35,
"concentration_max": 1.35,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.06,
"s_max": 4.458,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFE5_fit1_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "4d7m",
"ext_code": "4D7M",
"ext_type": "pdb",
"difference_with_model": "other"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFE5_fit1_model1.pdb",
"model_mw": 47.87,
"bead_radius": null,
"log": null,
"symmetry": "p2",
"comment": "A dimer was generated from the PDB entry by applying crystallographic symmetry",
"user": 438
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDFE5_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.76,
"p_value": 0.0,
"fit_residual_plot": "SASDFE5_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFE5_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/4d7m_dimer.log",
"software_version": "2.8.3",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of TetR(D), in complex with ATc in 50 mM Tris/HCl 150 mM NaCl 10 mM MgCl2, pH 8 were collected on the EMBL P12 beam line at PETRA III (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3.1 m and at a wavelength of λ = 0.124 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 1.4 and 1.4 mg/ml were measured at 10°C. 20 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 42.6,
"experimental_mw_error": null,
"guinier_i0_mw": 42.6,
"guinier_i0_mw_error": null,
"porod_mw": 48.2,
"porod_mw_error": null,
"pddf_i0": 7510.0,
"pddf_i0_error": null,
"guinier_i0": 7682.32,
"guinier_i0_error": 15.74,
"pddf_rg": 2.435,
"pddf_rg_error": null,
"guinier_rg": 2.55,
"guinier_rg_error": 0.06,
"pddf_dmax": 6.76,
"pddf_dmax_error": null,
"porod_volume": 77.16,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 14,
"guinier_point_last": 172,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDFE5_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDFE5",
"status": "success",
"started_at": "2026-08-11T14:46:22.131897+00:00",
"finished_at": "2026-08-11T14:46:31.944557+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFE5/",
"path": "/data/saxsdb/sasbdb/entries/e5/sasdfe5/source/summary.json",
"size": 8548,
"sha256": "cb40773dcc7598a7e1617b3eb3c0bae3923782c267fdfc31fbdbfe7eefade38f"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDFE5.dat",
"path": "/data/saxsdb/sasbdb/entries/e5/sasdfe5/source/SASDFE5.dat",
"size": 76958,
"sha256": "8fbd148c61174d32424d8b6ba7c12ac51f0b83445313522269e435d3a281a214",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDFE5.out",
"path": "/data/saxsdb/sasbdb/entries/e5/sasdfe5/source/SASDFE5.out",
"size": 103381,
"sha256": "a6fbb06308af46c9d02e351341db511165f75c60d25add9847fecd887ef46623",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFE5.sascif",
"path": "/data/saxsdb/sasbdb/entries/e5/sasdfe5/source/SASDFE5.sascif",
"size": 587878,
"sha256": "593982115ccce15d56dcaadc299130813e590fae0f69969eeb245d4713d548b9",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDFE5.zip",
"path": "/data/saxsdb/sasbdb/entries/e5/sasdfe5/source/SASDFE5.zip",
"size": 235624,
"sha256": "dc813f2d441d3722243bde156a0e103dcd1df54e279de36560e48852106cb669",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
