Mutant 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase, H110A tetramer, at pH 8.5

{
  "code": "SASDFM5",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "Quaternary structure of α-amino-β-carboxymuconate-ϵ-semialdehyde decarboxylase (ACMSD) controls its activity.",
    "publication": {
      "title": "Quaternary structure of α-amino-β-carboxymuconate-ϵ-semialdehyde decarboxylase (ACMSD) controls its activity.",
      "author_list": "Yang Y, Davis I, Matsui T, Rubalcava I, Liu A",
      "journal": "J Biol Chem",
      "doi": "10.1074/jbc.RA119.009035",
      "pmid": "31189654",
      "published_date": "2019 Jul 26"
    },
    "status": "released",
    "submitted_date": "2019-04-23",
    "released_date": "2019-06-19"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFM5.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFM5.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFM5_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFM5_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFM5_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFM5_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFM5.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 X 1M",
        "resolution": 0.172
      },
      "name": "Stanford Synchrotron Radiation Lightsource (SSRL)",
      "city": "Menlo Park, CA",
      "country": "USA",
      "beamline_name": "BL4-2",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "2-amino-3-carboxymuconate 6-semialdehyde decarboxylase",
          "short_name": "ACMSD",
          "sequence": "MGHHHHHHHHHHSSGHIEGRH\r\nMKKPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCAT\r\nPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATL\r\nEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRV\r\nDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDK\r\nIISGNASKFFNINV",
          "organism": "Pseudomonas fluorescens",
          "uniprot_code": "Q83V25",
          "uniprot_range_first": 1,
          "uniprot_range_last": 334,
          "oligomerization": "tetramer",
          "molecular_type": "protein",
          "uniprot_sequence": "MKKPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDP\nAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQ\nVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWD\nMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRV\nDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLG\nEQKIGGLVLSSNLGESAKDKIISGNASKFFNINV",
          "mw": 39.661,
          "total_mw": 158.644,
          "number_molecules": 4,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM Tris, 5 mM DTT",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Mutant 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase, H110A tetramer, at pH 8.5",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "San Antonia, TX, USA",
            "full_name": "University of Texas at San Antonio",
            "webpage": "https://www.utsa.edu/"
          }
        ],
        "contributor_name": "Yu",
        "contributor_surname": "Yang",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-07-15",
    "storage_temperature": 25.0,
    "cell_temperature": 25.0,
    "exposure_time": 1.0,
    "number_of_frames": 500,
    "wavelength": 0.1228,
    "sample_detector_distance": 2.5,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": 0.05,
    "flow_rate": null,
    "s_min": 0.14,
    "s_max": 3.003,
    "total_exposure_time": null,
    "seccolumn": 2
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFM5_fit1_model1_img.png",
          "software": "CORAL",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "mix",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDFM5_fit1_model1.pdb",
          "model_mw": 157.4,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 440
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/07-P2_Dimersr00_fixed_fit_img.png",
      "software": "CORAL",
      "chi_square_value": 0.25,
      "p_value": 0.063313,
      "fit_residual_plot": "07-P2_Dimersr00_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFM5_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of mutant ACMSD (H110A) in 50 mM Tris, 5 mM DTT, pH 8.5 were collected on the BL4-2 beam line at the Stanford Synchrotron Radiation Lightsource (SSRL; Menlo Park, CA, USA) using a Pilatus3 X 1M detector at a sample-detector distance of 2.5 m and at a wavelength of λ = 0.1228 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 0.05 ml sample at  mg/ml was injected onto a GE Superdex 200 Increase 5/150 column at 25°C. 500 successive 1 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 158.8,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 148.8,
  "porod_mw_error": null,
  "pddf_i0": 13.77,
  "pddf_i0_error": 0.19,
  "guinier_i0": 13.309,
  "guinier_i0_error": 0.376,
  "pddf_rg": 5.6,
  "pddf_rg_error": 0.08,
  "guinier_rg": 5.22,
  "guinier_rg_error": 0.195,
  "pddf_dmax": 19.0,
  "pddf_dmax_error": null,
  "porod_volume": 238.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 31,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDFM5_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDFM5",
  "status": "success",
  "started_at": "2026-08-11T14:51:00.479694+00:00",
  "finished_at": "2026-08-11T14:51:10.363597+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFM5/",
      "path": "/data/saxsdb/sasbdb/entries/m5/sasdfm5/source/summary.json",
      "size": 7801,
      "sha256": "af56852bc1ac7377ec05628239afa05e8a1f70175be96dd9a7e7f5161313efc5"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDFM5.dat",
      "path": "/data/saxsdb/sasbdb/entries/m5/sasdfm5/source/SASDFM5.dat",
      "size": 24636,
      "sha256": "85a9367a3a0736391264df3421dc1ae7def5816f6dab53a331bf113d40c7887b",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDFM5.out",
      "path": "/data/saxsdb/sasbdb/entries/m5/sasdfm5/source/SASDFM5.out",
      "size": 41625,
      "sha256": "91fd59162d245c45e516558120cbc1b6571fc78937d8b9715a4c590014d332b1",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFM5.sascif",
      "path": "/data/saxsdb/sasbdb/entries/m5/sasdfm5/source/SASDFM5.sascif",
      "size": 1177553,
      "sha256": "59736c99d51c4c17c813ec24d364a47fea45afe91b25327756019ef02e872159",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDFM5.zip",
      "path": "/data/saxsdb/sasbdb/entries/m5/sasdfm5/source/SASDFM5.zip",
      "size": 202481,
      "sha256": "bf41361613d97a96295d57c09f732468b6ecf414d0ece6601ea0d7d92a87f291",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}