Adenine specific DNA methyltransferase (Mod HP_0593) at pH 5.5

{
  "code": "SASDFM6",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Tetramerization at low pH licenses DNA methylation activity of M.HpyAXI in the presence of acid stress.",
    "publication": {
      "title": "Tetramerization at low pH licenses DNA methylation activity of M.HpyAXI in the presence of acid stress.",
      "author_list": "Narayanan N, Banerjee A, Jain D, Kulkarni DS, Sharma R, Nirwal S, Rao DN, Nair DT",
      "journal": "J Mol Biol",
      "doi": "10.1016/j.jmb.2019.10.001",
      "pmid": "31628946",
      "published_date": "2019 Oct 16"
    },
    "status": "released",
    "submitted_date": "2019-05-31",
    "released_date": "2019-11-17"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFM6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFM6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFM6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFM6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFM6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFM6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFM6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "Dectris",
        "name": "Pilatus 1M",
        "resolution": 172.0
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Adenine specific DNA methyltransferase (Mod)",
          "short_name": null,
          "sequence": "MLLKNFPQTIKDGQVSLSAIKMLLGFNESMNDISGYELTWTGKGFANALYSEPCQKQLKL\r\nQESFTPQTSASKHPNNAIIIGDNLDALKLLKSAYSEKIKMIYIDPPYNTGNDEFIYPDNF\r\nRQDYQKILREVGLMEIDENGKEIESESLKFFKNTQGSGTHSGWLSFMLPRLKLARDLLKE\r\nDGVIFISIDDNECANLKILCDEIFGEDNFVGDFIRKTKSTTNDAKIGLNYQHEFLLCYAK\r\nDKNYTNLLGGEKNLENYKNPDNDPNGAWINDNPSAKSGNMKTGYFGVTNPYTNKVDYPPV\r\nGMFWRFSQNTIQKHIDEGRICFKKEHKDNERGFIYKRYLKDLKTTQKTFDSLIFSDNCYM\r\nNQAATKELLNLGMGEYFTYPKGVEFMKKIILHSTTPNEGDIILDFFAGSGTTVHAVMELN\r\nAEDKGNREFILVQIDEEIKEDESAYDFCKKELKSAKPVISDITIERVKRAAQKISQLSKD\r\nSGLDLGFKVYTLQDKVQIINDKEEITLFNRSDLTPFDKALNLALQCGKTLNQALEIIIKD\r\nKLYKCEDAYFCIVCDEEAQEYLAKSKNEMIFLDGYEEIDLEAFLNLNASFKERLSVVY",
          "organism": "Helicobacter pylori",
          "uniprot_code": "O25315",
          "uniprot_range_first": 1,
          "uniprot_range_last": 598,
          "oligomerization": "tetramer",
          "molecular_type": "protein",
          "uniprot_sequence": "MLLKNFPQTIKDGQVSLSAIKMLLGFNESMNDISGYELTWTGKGFANALYSEPCQKQLKL\nQESFTPQTSASKHPNNAIIIGDNLDALKLLKSAYSEKIKMIYIDPPYNTGNDEFIYPDNF\nRQDYQKILREVGLMEIDENGKEIESESLKFFKNTQGSGTHSGWLSFMLPRLKLARDLLKE\nDGVIFISIDDNECANLKILCDEIFGEDNFVGDFIRKTKSTTNDAKIGLNYQHEFLLCYAK\nDKNYTNLLGGEKNLENYKNPDNDPNGAWINDNPSAKSGNMKTGYFGVTNPYTNKVDYPPV\nGMFWRFSQNTIQKHIDEGRICFKKEHKDNERGFIYKRYLKDLKTTQKTFDSLIFSDNCYM\nNQAATKELLNLGMGEYFTYPKGVEFMKKIILHSTTPNEGDIILDFFAGSGTTVHAVMELN\nAEDKGNREFILVQIDEEIKEDESAYDFCKKELKSAKPVISDITIERVKRAAQKISQLSKD\nSGLDLGFKVYTLQDKVQIINDKEEITLFNRSDLTPFDKALNLALQCGKTLNQALEIIIKD\nKLYKCEDAYFCIVCDEEAQEYLAKSKNEMIFLDGYEEIDLEAFLNLNASFKERLSVVY",
          "mw": 68.367,
          "total_mw": 273.468,
          "number_molecules": 4,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "25 mM citrate, 250 mM NaCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 5.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Adenine specific DNA methyltransferase (Mod HP_0593) at pH 5.5",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "RCB",
            "address": "Haryana, India",
            "full_name": "Regional Centre for Biotechnology",
            "webpage": "http://www.rcb.res.in/"
          }
        ],
        "contributor_name": "Naveen",
        "contributor_surname": "Narayanan",
        "orcid": "https://orcid.org/0000-0001-8327-1559"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-12-01",
    "storage_temperature": null,
    "cell_temperature": null,
    "exposure_time": null,
    "number_of_frames": null,
    "wavelength": null,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": 2.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.038,
    "s_max": 4.946,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFM6_fit1_model1_img.png",
          "software": "PyMOL",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDFM6_fit1_model1.pdb",
          "model_mw": 233.8,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 451
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/tetramer_after_md00_fixed_fit_img.png",
      "software": "CRYSOL",
      "chi_square_value": 1.796,
      "p_value": 0.0,
      "fit_residual_plot": "tetramer_after_md00_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFM6_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "The sample is severely aggregated. Wavelength UNKNOWN; Experimental temperature, UNKNOWN; Exposure time, UNKNOWN; Sample to detector distance, UNKNOWN.",
  "experiment_description": "Synchrotron SAXS data from solutions of adenine specific DNA methyltransferase (Mod HP_0593) at pH 5.5 in 25 mM citrate, 250 mM NaCl were collected on the BM29 beam line at the ESRF storage ring (Grenoble, France) using a Pilatus 1M detector (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.00 mg/ml was measured. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 250.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 209.0,
  "porod_mw_error": null,
  "pddf_i0": 122.9,
  "pddf_i0_error": null,
  "guinier_i0": 126.76,
  "guinier_i0_error": 0.8,
  "pddf_rg": 4.91,
  "pddf_rg_error": null,
  "guinier_rg": 4.98,
  "guinier_rg_error": 0.42,
  "pddf_dmax": 19.1,
  "pddf_dmax_error": null,
  "porod_volume": 316.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 18,
  "guinier_point_last": 47,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDFM6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDFM6",
  "status": "success",
  "started_at": "2026-08-11T15:12:28.105945+00:00",
  "finished_at": "2026-08-11T15:12:40.244100+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFM6/",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasdfm6/source/summary.json",
      "size": 8218,
      "sha256": "596d0c413fcc9812aa1b05c8fbfe50f0a3ef6e35a53e356962a407f272d60105"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDFM6.dat",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasdfm6/source/SASDFM6.dat",
      "size": 57407,
      "sha256": "6df2a697931aafb9a513a62194aed5b3726fd099c99377f0bc73ec2f50173512",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDFM6.out",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasdfm6/source/SASDFM6.out",
      "size": 35820,
      "sha256": "7a3c8e7dcd7e872ca45a448cd4e8b11526633a027f00f4f8870d9577f49557f7",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFM6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasdfm6/source/SASDFM6.sascif",
      "size": 3553923,
      "sha256": "e7da950b625e8f43fd749c0495e6bf217ad79bf2b5f7660de1f7d234d25cbebe",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDFM6.zip",
      "path": "/data/saxsdb/sasbdb/entries/m6/sasdfm6/source/SASDFM6.zip",
      "size": 534153,
      "sha256": "3b7e8493508d470665068d64d81bb600ff6453570ef51a309385003030836aeb",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}