Complex with 1H histone chaperones Asf1 and Vps75 and histones H3 and H4, 70%-2H histone acetyltransferase Rtt109 (1H Asf1-H3:H4-Vps75, 2H(70%) Rtt109) acquired in 100% v/v D2O

{
  "code": "SASDFN3",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Histone chaperone exploits intrinsic disorder to switch acetylation specificity.",
    "publication": {
      "title": "Histone chaperone exploits intrinsic disorder to switch acetylation specificity.",
      "author_list": "Danilenko N, Lercher L, Kirkpatrick J, Gabel F, Codutti L, Carlomagno T",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-019-11410-7",
      "pmid": "31387991",
      "published_date": "2019 Aug 6"
    },
    "status": "released",
    "submitted_date": "2019-02-27",
    "released_date": "2019-07-10"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFN3.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFN3.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFN3_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFN3_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFN3_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFN3_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFN3.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "SANS",
        "name": "6Li-Scintillator 1 mm thickness + photomultiplier",
        "resolution": 5.3
      },
      "name": "FRM2",
      "city": "Munich",
      "country": "Germany",
      "beamline_name": "KWS1",
      "beam_geometry": null,
      "type_of_source": "neutron source",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Vacuolar protein sorting-associated protein 75 (1-225 aa)",
          "short_name": "Vps75 1-225",
          "sequence": "MMSDQENENEHAKAFLGLAKCEEEVDAIEREVELYRLNKMKPVYEKRDAYIDEIAEFWKI\r\nVLSQHVSFANYIRASDFKYIDTIDKIKVEWLALESEMYDTRDFSITFHFHGIEGDFKEQQ\r\nVTKVFQIKKGKDDQEDGILTSEPVPIEWPQSYDSINPDLIKDKRSPEGKKKYRQGMKTIF\r\nGWFRWTGLKPGKEFPHGDSLASLFSEEIYPFCVKYYAEAQRDLED",
          "organism": "Saccharomyces cerevisiae",
          "uniprot_code": "P53853",
          "uniprot_range_first": 1,
          "uniprot_range_last": 225,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MMSDQENENEHAKAFLGLAKCEEEVDAIEREVELYRLNKMKPVYEKRDAYIDEIAEFWKI\nVLSQHVSFANYIRASDFKYIDTIDKIKVEWLALESEMYDTRDFSITFHFHGIEGDFKEQQ\nVTKVFQIKKGKDDQEDGILTSEPVPIEWPQSYDSINPDLIKDKRSPEGKKKYRQGMKTIF\nGWFRWTGLKPGKEFPHGDSLASLFSEEIYPFCVKYYAEAQRDLEDEEGESGLSADGDSED\nDDGSLGEVDLPLSDEEPSSKKRKV",
          "mw": 26.554,
          "total_mw": 53.108,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Histone acetyltransferase RTT109",
          "short_name": "Rtt109",
          "sequence": "MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGK\r\nVFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL\r\nQKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT\r\nCPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA\r\nKLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE\r\nDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA\r\nIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPASNINTLA\r\nITMLKPRKKAKALPKT",
          "organism": "Saccharomyces cerevisiae",
          "uniprot_code": "Q07794",
          "uniprot_range_first": 1,
          "uniprot_range_last": 436,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGK\nVFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL\nQKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT\nCPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA\nKLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE\nDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA\nIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPASNINTLA\nITMLKPRKKAKALPKT",
          "mw": 50.095,
          "total_mw": 50.095,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Histone chaperone ASF1",
          "short_name": "Asf1",
          "sequence": "MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSI\r\nLVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEE\r\nELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDLYPPEQPGV",
          "organism": null,
          "uniprot_code": "P32447",
          "uniprot_range_first": 1,
          "uniprot_range_last": 169,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSI\nLVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEE\nELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENEGDLYPPEQPGVDDEEEEDDEEE\nDDDEDDEDDEDDDQEDGEGEAEEAAEEEEEEEEKTEDNETNLEEEEEDIENSDGDEEEGE\nEEVGSVDKNEDGNDKKRRKIEGGSTDIESTPKDAARSTN",
          "mw": 19.125,
          "total_mw": 19.125,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Histone H3.2 (35-135 aa)",
          "short_name": "H3 (35-135)",
          "sequence": "VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAY \r\nLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA",
          "organism": "Xenopus laevis",
          "uniprot_code": "P84233",
          "uniprot_range_first": 35,
          "uniprot_range_last": 135,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE\nLLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI\nMPKDIQLARRIRGERA",
          "mw": 11.747,
          "total_mw": 11.747,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        },
        {
          "long_name": "Histone H4",
          "short_name": "H4",
          "sequence": "MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK\r\nVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG",
          "organism": "Xenopus laevis",
          "uniprot_code": "P62799",
          "uniprot_range_first": 1,
          "uniprot_range_last": 103,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK\nVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG",
          "mw": 11.367,
          "total_mw": 11.367,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM citrate, 150 mM NaCl, 5 mM BME, 100% D2O",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Complex with 1H histone chaperones Asf1 and Vps75 and histones H3 and H4, 70%-2H histone acetyltransferase Rtt109 (1H Asf1-H3:H4-Vps75, 2H(70%) Rtt109) acquired in 100% v/v D2O",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Germany",
            "full_name": "Leibniz University of Hannover",
            "webpage": "https://www.uni-hannover.de"
          }
        ],
        "contributor_name": "Nataliya",
        "contributor_surname": "Danilenko",
        "orcid": "https://orcid.org/0000-0003-4885-5051"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-03-04",
    "storage_temperature": 25.0,
    "cell_temperature": 25.0,
    "exposure_time": 9000.0,
    "number_of_frames": 1,
    "wavelength": 0.5,
    "sample_detector_distance": 4.0,
    "concentration_min": null,
    "concentration_max": 3.8,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.127,
    "s_max": 4.428,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFN3_fit1_model1_img.png",
          "software": "HADDOCK",
          "pdb_link": [
            {
              "pdb_code": "6o22",
              "ext_code": "6O22",
              "ext_type": "pdb",
              "difference_with_model": "derived"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDFN3_fit1_model1.pdb",
          "model_mw": 144.0,
          "bead_radius": null,
          "log": "https://www.sasbdb.org/media/log_files/new190718_12002.log",
          "symmetry": null,
          "comment": null,
          "user": 420
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/new190718_12002_fit_img.png",
      "software": "CRYSON",
      "chi_square_value": 2.894,
      "p_value": 0.007065,
      "fit_residual_plot": null,
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFN3_fit1.fit",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/new190718_12002.log",
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "4.5a",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SANS data from solutions of the Asf1-H3:H4-Rtt109-Vps75 protein complex (1H Asf1-H3:H4-Vps75, bound to 70% 2H-labelled Rtt109) in 50 mM citrate, 150 mM NaCl, 5 mM BME, 100% D2O, pD 6.5 were collected on the KWS1 instrument at FRM2 (Munich, Germany) using a SANS 6Li-Scintillator 1 mm thickness + photomultiplier detector at a sample-detector. The data were recorded at two detector configurations: 1) 4 m for 2.5 hrs using a neutron wavelength of 0.5 nm and; 2) 1.5 m for 2.5 hrs using a neutron wavelength of 0.5 nm. Both measurement were performed on the same sample at 3.8 mg/mL, measured at 25°C.",
  "tags": [],
  "intensity_unit": null,
  "experimental_mw": 96.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 0.167,
  "pddf_i0_error": null,
  "guinier_i0": 0.17,
  "guinier_i0_error": 0.00051,
  "pddf_rg": 3.31,
  "pddf_rg_error": null,
  "guinier_rg": 3.282,
  "guinier_rg_error": 0.046,
  "pddf_dmax": 10.5,
  "pddf_dmax_error": null,
  "porod_volume": null,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 15,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDFN3_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2019-12-06T13:07:15.624532+01:00",
  "bragg_peak": []
}

{
  "code": "SASDFN3",
  "status": "success",
  "started_at": "2026-08-11T14:03:59.941779+00:00",
  "finished_at": "2026-08-11T14:04:08.698770+00:00",
  "source_last_modified": "2019-12-06T13:07:15.624532+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFN3/",
      "path": "/data/saxsdb/sasbdb/entries/n3/sasdfn3/source/summary.json",
      "size": 12156,
      "sha256": "db1cbb0f58560a63fe2acffcf9393767e36791287cff122e4be2db4890676fa5"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDFN3.dat",
      "path": "/data/saxsdb/sasbdb/entries/n3/sasdfn3/source/SASDFN3.dat",
      "size": 4362,
      "sha256": "e1f8a03c918d3b9d2b46b65defbb63c152dbb0533bacc81d679362dd90e52e2a",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDFN3.out",
      "path": "/data/saxsdb/sasbdb/entries/n3/sasdfn3/source/SASDFN3.out",
      "size": 13632,
      "sha256": "245755c229f1395fbc8ce7aa3e41a2c2efface5c4459764b04dfd1ece186a36a",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFN3.sascif",
      "path": "/data/saxsdb/sasbdb/entries/n3/sasdfn3/source/SASDFN3.sascif",
      "size": 1292844,
      "sha256": "4b80098ca6a8ee1c750d3211d7c5bf204eee3f0ec90e463cb01b35e16e95a0f0",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDFN3.zip",
      "path": "/data/saxsdb/sasbdb/entries/n3/sasdfn3/source/SASDFN3.zip",
      "size": 205361,
      "sha256": "c36195aa83c84df5a0ef1db655d24421af17912343d79dc876734a8336abecc8",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}