The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDFR7",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Rabbit muscle fructose-1,6-bisphosphate aldolase K229M mutant",
"publication": null,
"status": "released",
"submitted_date": "2019-06-21",
"released_date": "2021-02-15"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFR7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFR7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFR7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFR7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFR7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFR7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFR7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "pixel counting",
"name": "Pilatus3 R 300K",
"resolution": 172.0
},
"name": "Département de Biochimie, Université de Montréal",
"city": "Montréal",
"country": "Canada",
"beamline_name": "Xenocs BioXolver L with MetalJet",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Fructose-bisphosphate aldolase A",
"short_name": "Aldolase",
"sequence": ">FBP aldolase\r\nPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH\r\nETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSA\r\nLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLMPNMVTPGHACT\r\nQKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENL\r\nKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFISNHAY",
"organism": "Oryctolagus cuniculus",
"uniprot_code": "P00883",
"uniprot_range_first": 2,
"uniprot_range_last": 364,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR\nQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN\nGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ\nNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC\nTQKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTF\nSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFIS\nNHAY",
"mw": 39.214,
"total_mw": 156.856,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM HEPES",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Rabbit muscle fructose-bisphosphate aldolase A, K229M mutant",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Montréal, Canada",
"full_name": "Département de biochimie, Université de Montréal",
"webpage": "http://www.umontreal.ca/"
}
],
"contributor_name": "Normand",
"contributor_surname": "Cyr",
"orcid": "https://orcid.org/0000-0002-9024-525X"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2019-06-14",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 60.0,
"number_of_frames": 10,
"wavelength": 1.348,
"sample_detector_distance": 600.0,
"concentration_min": null,
"concentration_max": 8.66,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.107,
"s_max": 3.999,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFR7_fit1_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "5f4x",
"ext_code": "5F4X",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFR7_fit1_model1.pdb",
"model_mw": 157.0,
"bead_radius": null,
"log": null,
"symmetry": "P222",
"comment": null,
"user": 462
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDFR7_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.659,
"p_value": 2.1e-05,
"fit_residual_plot": "SASDFR7_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFR7_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/5f4x01.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFR7_fit2_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFR7_fit2_model1.pdb",
"model_mw": 108.725,
"bead_radius": 3.5,
"log": "https://www.sasbdb.org/media/log_files/dammin.log",
"symmetry": "P1",
"comment": null,
"user": 462
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDFR7_fit2_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.178,
"p_value": 0.008512,
"fit_residual_plot": "SASDFR7_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFR7_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/dammin_rLIHezm.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of rabbit muscle fructose-bisphosphate aldolase A (K229M) in 20 mM HEPES, pH 7 were collected using Xenocs BioXolver L instrument with MetalJet (Département de Biochimie, Université de Montréal, Canada) with a Pilatus3 R 300K detector at a wavelength of λ = 1.348 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 8.66 mg/ml was measured at 20°C. 10 successive 60 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 157.3,
"experimental_mw_error": null,
"guinier_i0_mw": 160.0,
"guinier_i0_mw_error": null,
"porod_mw": 133.0,
"porod_mw_error": null,
"pddf_i0": 0.1303,
"pddf_i0_error": 0.0002174,
"guinier_i0": 0.1302,
"guinier_i0_error": 0.0002708,
"pddf_rg": 3.6,
"pddf_rg_error": 0.007,
"guinier_rg": 3.602,
"guinier_rg_error": 0.011,
"pddf_dmax": 11.8,
"pddf_dmax_error": null,
"porod_volume": 213.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 20,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDFR7_datloglog_img.png",
"symmetry": null,
"last_modified": "2022-08-22T09:53:00.976207+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDFR7",
"status": "success",
"started_at": "2026-08-11T15:37:04.965364+00:00",
"finished_at": "2026-08-11T15:37:21.699315+00:00",
"source_last_modified": "2022-08-22T09:53:00.976207+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFR7/",
"path": "/data/saxsdb/sasbdb/entries/r7/sasdfr7/source/summary.json",
"size": 8785,
"sha256": "94bb4c837f0b954ea6f32236f78482155d9c44bed956edc0c6b6a0db4258c4e0"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDFR7.dat",
"path": "/data/saxsdb/sasbdb/entries/r7/sasdfr7/source/SASDFR7.dat",
"size": 21313,
"sha256": "a5e13f2f58c3a974ceb740a57a53272497085f38e850472288c36b3cdc2c3a94",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDFR7.out",
"path": "/data/saxsdb/sasbdb/entries/r7/sasdfr7/source/SASDFR7.out",
"size": 41713,
"sha256": "d8610632c38f7ea8aae6ca5a6892810e1643fd387a8042f426c5ce56336690b5",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFR7.sascif",
"path": "/data/saxsdb/sasbdb/entries/r7/sasdfr7/source/SASDFR7.sascif",
"size": 2503187,
"sha256": "33049a0a07837cf26ff536de267f9a72ee74c34cc891b1a62e9336bded3ac8dc",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDFR7.zip",
"path": "/data/saxsdb/sasbdb/entries/r7/sasdfr7/source/SASDFR7.zip",
"size": 525346,
"sha256": "172dc3d7c9e02ffc8cde9b832d9bb07248fc0cad128dec74d5aa155de1b07063",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
