The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDFT3",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "A Dissection of Oligomerisation by the TRIM28 Tripartite Motif and the Interaction with Members of the Krab-ZFP Family.",
"publication": {
"title": "A Dissection of Oligomerisation by the TRIM28 Tripartite Motif and the Interaction with Members of the Krab-ZFP Family.",
"author_list": "Sun Y, Keown JR, Black MM, Raclot C, Demarais N, Trono D, Turelli P, Goldstone DC",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2019.05.002",
"pmid": "31078555",
"published_date": "2019 May 9"
},
"status": "released",
"submitted_date": "2019-03-06",
"released_date": "2019-05-16"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFT3.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFT3.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFT3_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFT3_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFT3_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFT3_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFT3.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": "Point",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Transcription intermediary factor 1-beta",
"short_name": "TRIM28",
"sequence": "GPGEAQELLEHCGVCRERLRPERDPRLLPCLHSACSACLGPATPAAANNSGDGGSAGDGAMVDCPVCKQQCYSKDIVENYFMRDSGSKASSDSQDANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKTRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKNTKEVRSSIRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNS",
"organism": "Mus musculus",
"uniprot_code": "Q62318",
"uniprot_range_first": 58,
"uniprot_range_last": 418,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MAASAAATAAASAATAASAASGSPGSGEGSAGGEKRPAASSAAAASAAASSPAGGGGEAQ\nELLEHCGVCRERLRPERDPRLLPCLHSACSACLGPATPAAANNSGDGGSAGDGAMVDCPV\nCKQQCYSKDIVENYFMRDSGSKASSDSQDANQCCTSCEDNAPATSYCVECSEPLCETCVE\nAHQRVKYTKDHTVRSTGPAKTRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKD\nHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKNTKEVRSSIRQVSDVQKRVQVDVKMAI\nLQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNT\nALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTG\nPGPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSDDPYSSAEPHVSGMKRSRSGEGEVSG\nLLRKVPRVSLERLDLDLTSDSQPPVFKVFPGSTTEDYNLIVIERGAAAAAAGQAGTVPPG\nAPGAPPLPGMAIVKEEETEAAIGAPPAAPEGPETKPVLMPLTEGPGAEGPRLASPSGSTS\nSGLEVVAPEVTSAPVSGPGILDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVP\nGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPL\nHQLATDSTFSMEQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKA\nDVQSIIGLQRFFETRMNDAFGDTKFSAVLVEPPPLNLPSAGLSSQELSGPGDGP",
"mw": 40.928,
"total_mw": 81.856,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Zinc finger protein 809 N-terminal MBP fusion",
"short_name": "MBP-ZFP809",
"sequence": "MLVIWINGDKGYNGLAQVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNGSTSGGGGSNNNPPTPTPSSGSGHHHHHHSAALEVLFQGPGMGLVSFEDVAVDFTLEEWQDLDAAQRTLYRDVMLETYSSLVFLDPCIAKPKLIFNLERGFGPWSLAEASSRSLP",
"organism": "Mus musculus",
"uniprot_code": "G3X9G7",
"uniprot_range_first": 1,
"uniprot_range_last": 74,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MGLVSFEDVAVDFTLEEWQDLDAAQRTLYRDVMLETYSSLVFLDPCIAKPKLIFNLERGF\nGPWSLAEASSRSLPGVHNVSTLSDTSKKIPKTRLRQLRKTNQKTPSEDTIEAELKARQEV\nSKGTTSRHRRAPVKSLCRKSQRTKNQTSYNDGNLYECKDCEKVFCNNSTLIKHYRRTHNV\nYKPYECDECSKMYYWKSDLTSHQKTHRQRKRIYECSECGKAFFRKSHLNAHERTHSGEKP\nYECTECRKAFYYKSDLTRHKKTHLGEKPFKCEECKKAFSRKSKLAIHQKKHTGEKPYECT\nECKKAFSHQSQLTAHRIAHSSENPYECKECNKSFHWKCQLTAHQKRHTGVTYFQEVVFQQ\nITVSDWTGNLSENGPHRPTWTWAYGIMDFVKAWSRCIIGGGL",
"mw": 52.099,
"total_mw": 52.099,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "10 mM Tris 300 mM NaCl 0.1 mM TCEP",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Murine transcription intermediary factor 1-beta, TRIM28 RBCC assembly-null mutation R184D, complexed with the Krab domain of ZFP809 fused to an N-terminal MBP",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Auckland, New Zealand",
"full_name": "The University of Auckland",
"webpage": "https://www.auckland.ac.nz"
}
],
"contributor_name": "Yunyuan",
"contributor_surname": "Sun",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-08-10",
"storage_temperature": null,
"cell_temperature": 16.0,
"exposure_time": 1.0,
"number_of_frames": 48,
"wavelength": 0.113,
"sample_detector_distance": 3.3,
"concentration_min": 0.15,
"concentration_max": 0.3,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.043,
"s_max": 2.843,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFT3_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFT3_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/complex.log",
"symmetry": "p1",
"comment": null,
"user": 423
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/complex_fit_img.png",
"software": "GASBOR",
"chi_square_value": 0.69,
"p_value": 0.099471,
"fit_residual_plot": "complex_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFT3_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/complex.log",
"software_version": "2.3i",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of TRIM28 RBCC_R184D in complex with MBP-Krab ZFP809 in 10 mM Tris 300 mM NaCl 0.1 mM TCEP, pH 8 were collected using size-exclusion chromatography SAXS (SEC-SAXS) on the SAXS/WAXS beam line at the Australian Synchrotron (Melbourne, Australia) using a Pilatus 1M detector at a sample-detector distance of 3.3 m and at a wavelength of λ = 0.113 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). SEC-SAXS was performed at 16 °C using the GE-Healthcare S200 5/150 analytical SEC column at a flow rate of 0.5 mL/min. Two successive 50 μL samples were loaded at 1:1 RBCC to MBP-Krab and 1:1.5 RBCC to MBP-Krab molar ratios, at concentrations of 11.2 and 14.3 mg/mL, respectively. The data were collected through the SEC peaks of each individual run as a series of 48 x 1 second exposures . The data were normalized to the intensity of the transmitted beam and radially averaged and the the scattering of an appropriate solvent-blank was subtracted. Both samples yielded identical scattering curves after buffer subtraction and therefore have been scaled and merged to generate the final SAXS profile displayed in this entry.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 138.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.06258,
"pddf_i0_error": null,
"guinier_i0": 0.062,
"guinier_i0_error": 0.00024,
"pddf_rg": 6.58,
"pddf_rg_error": null,
"guinier_rg": 6.38,
"guinier_rg_error": 0.046,
"pddf_dmax": 22.0,
"pddf_dmax_error": null,
"porod_volume": 252.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 3,
"guinier_point_last": 43,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDFT3_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDFT3",
"status": "success",
"started_at": "2026-08-11T14:07:07.140806+00:00",
"finished_at": "2026-08-11T14:07:15.824073+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFT3/",
"path": "/data/saxsdb/sasbdb/entries/t3/sasdft3/source/summary.json",
"size": 10446,
"sha256": "ece61a828c8fe374218f12925f34dc072e08b630a98cb1ed7b54c9751edbcac1"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDFT3.dat",
"path": "/data/saxsdb/sasbdb/entries/t3/sasdft3/source/SASDFT3.dat",
"size": 42423,
"sha256": "9aada4a202a7f8eb9ff86271f5587929ddb7cd19f4a3d9c5c06c29bb265d6c40",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDFT3.out",
"path": "/data/saxsdb/sasbdb/entries/t3/sasdft3/source/SASDFT3.out",
"size": 76638,
"sha256": "57c7c0cfadc3e23edf54ac1d78e296e1d1ce343b55b28af7823b5c15c9d8a2a4",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFT3.sascif",
"path": "/data/saxsdb/sasbdb/entries/t3/sasdft3/source/SASDFT3.sascif",
"size": 368477,
"sha256": "da9590cca861d1d4a946a68a457337d6c8e5c993a3885af270c3e15861a00090",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDFT3.zip",
"path": "/data/saxsdb/sasbdb/entries/t3/sasdft3/source/SASDFT3.zip",
"size": 80239,
"sha256": "c41ad47b5f64e36af7ee47026b520a1018b246551072846ba8f765e6dfb09136",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
