Salt stress-induced protein at a sample concentration of 22mg/ml

{
  "code": "SASDG27",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structural insights into rice SalTol QTL located SALT protein.",
    "publication": {
      "title": "Structural insights into rice SalTol QTL located SALT protein.",
      "author_list": "Kaur N, Sagar A, Sharma P, Ashish, Pati PK",
      "journal": "Sci Rep",
      "doi": "10.1038/s41598-020-73517-y",
      "pmid": "33024209",
      "published_date": "2020 Oct 6"
    },
    "status": "released",
    "submitted_date": "2019-10-14",
    "released_date": "2020-10-28"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDG27.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDG27.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG27_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG27.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "1D diode array detector",
        "name": "Mythen 1K",
        "resolution": 50.0
      },
      "name": "CSIR - Institute of Microbial Technology (IMTech)",
      "city": "Chandigarh",
      "country": "India",
      "beamline_name": "Anton Paar SAXSpace",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Salt stress-induced protein",
          "short_name": "SALT",
          "sequence": ">SLT\r\nMGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMTLVKIGLWGGNGGSAQDISVPPKKLLGVTIYSSDAIRSIAFNYIGVDGQEYAIGPWGGGEGTSTEIKLGSSEHIKEISGTHGPVYDLADIVTYLKIVTSANNTYEAGVPNGKEFSIPLQDSGHVVGFFGRSGTLIDAIGIYVHP",
          "organism": "Oryza sativa Indica Group",
          "uniprot_code": "A2WPN7",
          "uniprot_range_first": 1,
          "uniprot_range_last": 145,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MTLVKIGLWGGNGGSAQDISVPPKKLLGVTIYSSDAIRSIAFNYIGVDGQEYAIGPWGGG\nEGTSTEIKLGSSEHIKEISGTHGPVYDLADIVTYLKIVTSANNTYEAGVPNGKEFSIPLQ\nDSGHVVGFFGRSGTLIDAIGIYVHP",
          "mw": 18.741,
          "total_mw": 37.482,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Salt stress-induced protein at a sample concentration of 22mg/ml",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "CSIR",
            "address": "Chandigarh, India",
            "full_name": "CSIR-Institute of Microbial Technology",
            "webpage": "http://www.imtech.res.in/"
          }
        ],
        "contributor_name": "Amin",
        "contributor_surname": "Sagar",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-03-06",
    "storage_temperature": 4.0,
    "cell_temperature": 10.0,
    "exposure_time": 600.0,
    "number_of_frames": 3,
    "wavelength": 0.15418,
    "sample_detector_distance": 0.3176,
    "concentration_min": null,
    "concentration_max": 22.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.126,
    "s_max": 6.001,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of salt stress-induced protein in 50 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, pH 7.4 were collected using an Anton Paar SAXSpace instrument (CSIR - Institute of Microbial Technology (IMTech), Chandigarh, India) equipped with a Mythen 1K detector at a sample-detector distance of 0.3 m and at a wavelength of λ = 0.15418 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 22.00 mg/ml was measured at 10°C. Three successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 41.9,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 35.0,
  "porod_mw_error": null,
  "pddf_i0": 74920.0,
  "pddf_i0_error": null,
  "guinier_i0": 80553.5,
  "guinier_i0_error": 753.8,
  "pddf_rg": 2.3,
  "pddf_rg_error": null,
  "guinier_rg": 2.45,
  "guinier_rg_error": 0.19,
  "pddf_dmax": 6.5,
  "pddf_dmax_error": null,
  "porod_volume": 57.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 11,
  "guinier_point_last": 64,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDG27_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-10-28T14:30:50.727237+01:00",
  "bragg_peak": []
}

{
  "code": "SASDG27",
  "status": "success",
  "started_at": "2026-08-11T15:20:15.565930+00:00",
  "finished_at": "2026-08-11T15:20:23.392876+00:00",
  "source_last_modified": "2020-10-28T14:30:50.727237+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDG27/",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/summary.json",
      "size": 6240,
      "sha256": "b79b8d3eecf083b9b027e29a107afa04f0a6d64a8b33f2e6a20ee3026133e6d9"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDG27.dat",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.dat",
      "size": 32319,
      "sha256": "b8a4f9e789116dcdfb3d8fea372bf45f3aecdf5e19af9b26ecf71a8746cb716e",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDG27.out",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.out",
      "size": 39242,
      "sha256": "cff3e8ab111c590f68373009af2647bebd84202b45eef084d37498d2a49605cf",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG27.sascif",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.sascif",
      "size": 79611,
      "sha256": "cf5800bfcea70940afa868502669c786b625bec62662eff8d28df4dbc79f2830",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDG27.zip",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.zip",
      "size": 25334,
      "sha256": "dbad312aa11bca8c75c1263e5ef6090802b3251c4765c622601d9f4322060a6d",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}