The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDG56",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Flexible Tethering of ASPP Proteins Facilitates PP-1c Catalysis.",
"publication": {
"title": "Flexible Tethering of ASPP Proteins Facilitates PP-1c Catalysis.",
"author_list": "Zhou Y, Millott R, Kim HJ, Peng S, Edwards RA, Skene-Arnold T, Hammel M, Lees-Miller SP, Tainer JA, Holmes CFB, Glover JNM",
"journal": "Structure",
"doi": "10.1016/j.str.2019.07.012",
"pmid": "31402222",
"published_date": "2019 Oct 1"
},
"status": "released",
"submitted_date": "2019-10-02",
"released_date": "2019-11-01"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDG56.dat",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDG56.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG56_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG56_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG56_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG56_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG56.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 X 2M",
"resolution": 172.0
},
"name": "Advanced Light Source (ALS)",
"city": "Berkeley, CA",
"country": "USA",
"beamline_name": "12.3.1 (SIBYLS)",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit",
"short_name": "PP-1cα",
"sequence": "MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK",
"organism": "Homo sapiens",
"uniprot_code": "P62136",
"uniprot_range_first": 1,
"uniprot_range_last": 330,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK\nICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL\nLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL\nQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD\nLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD\nKNKGKYGQFSGLNPGGRPITPPRNSAKAKK",
"mw": 37.512,
"total_mw": 37.512,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Inhibitor of apoptosis-stimulating protein of p53 (RelA-associated inhibitor)",
"short_name": "iASPP",
"sequence": "MAHHHHHHSAALEVLFQGPGYQDPRRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV",
"organism": "Homo sapiens",
"uniprot_code": "Q8WUF5",
"uniprot_range_first": 621,
"uniprot_range_last": 828,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQ\nAGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSS\nPRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR\nAGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDL\nTLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPASPSLQLLPWRESSLDGLGGTG\nKDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ\nPRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQP\nQPQLPPQPQTQPQTPTPAPQHPQQTWPPVNEGPPKPPTELEPEPEIEGLLTPVLEAGDVD\nEGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK\nKQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPE\nQPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEG\nITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIF\nATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFR\nEGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV",
"mw": 25.492,
"total_mw": 25.492,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM Tris, 150 mM NaCl, 1 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Inhibitor of apoptosis-stimulating protein of p53 (iASPP(621-828)) bound to the serine/threonine-protein phosphatase PP1-alpha catalytic subunit, extended",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Edmonton, AB T6G 2R3, Canada",
"full_name": "University of Alberta",
"webpage": ""
}
],
"contributor_name": "Hyeong Jin",
"contributor_surname": "Kim",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2019-04-25",
"storage_temperature": 7.0,
"cell_temperature": 20.0,
"exposure_time": 3.0,
"number_of_frames": 600,
"wavelength": 0.103,
"sample_detector_distance": 2.1,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": 0.5,
"s_min": 0.131,
"s_max": 2.912,
"total_exposure_time": null,
"seccolumn": 17
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG56_fit1_model1_img.png",
"software": "BILBOMD",
"pdb_link": [
{
"pdb_code": "6dcx",
"ext_code": "6DCX",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG56_fit1_model1.pdb",
"model_mw": null,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "43%",
"user": 456
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG56_fit1_model2_img.png",
"software": "BILBOMD",
"pdb_link": [
{
"pdb_code": "6dcx",
"ext_code": "6DCX",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG56_fit1_model2.pdb",
"model_mw": null,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "36%",
"user": 456
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG56_fit1_model3_img.png",
"software": "BILBOMD",
"pdb_link": [
{
"pdb_code": "6dcx",
"ext_code": "6DCX",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG56_fit1_model3.pdb",
"model_mw": null,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "21%",
"user": 456
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/avg_optimal_Po3W2SY_2BWMR0a_fitfoxs_img.png",
"software": "MES-FoXS",
"chi_square_value": 1.407687,
"p_value": 2.8e-05,
"fit_residual_plot": "avg_optimal_Po3W2SY_2BWMR0a_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG56_fit1.dat",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ScÅtter",
"pddf_software_version": "3.1",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 65.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 4036.894,
"pddf_i0_error": null,
"guinier_i0": 611.3,
"guinier_i0_error": 1.33,
"pddf_rg": 3.47,
"pddf_rg_error": null,
"guinier_rg": 3.372,
"guinier_rg_error": 0.4,
"pddf_dmax": 12.4,
"pddf_dmax_error": null,
"porod_volume": 132.4,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 5,
"guinier_point_last": 57,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDG56_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}
