The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Open the original SASBDB entry
Buffer and Sample Properties
Acquisition Conditions and Instrument
Original SASBDB Plots Experimental I(q) Experimental I(q), log-log Guinier plot Kratky plot P(r) plot Downloadable Files
curve：source record {
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/SASDG65.dat",
"role": "curve",
"sha256": "92a788468210e5fe668ab6148f74bf8bfdd011f901e086031a408f91b2c11614",
"size": 34333,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDG65.dat"
} full_entry_zip：source record and ZIP contents (4 items) {
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/SASDG65.zip",
"role": "full_entry_zip",
"sha256": "6212a3a66c4727770a98a29c3cde3738754f1f293b72fa8df1d9d363c92a8362",
"size": 45388,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDG65.zip",
"zip_member_count": 4,
"zip_members": [
{
"crc32": "93f64ecb",
"name": "SASDG65/experimental_data/SASDG65.dat",
"size": 34333
},
{
"crc32": "7d38faf0",
"name": "SASDG65/pddf/SASDG65.out",
"size": 56062
},
{
"crc32": "9eae4b34",
"name": "SASDG65/SASDG65_fit1.fir",
"size": 30440
},
{
"crc32": "331e5915",
"name": "SASDG65/SASDG65_fit1_model1.pdb",
"size": 42127
}
],
"zip_validation": "central_directory_readable"
} pddf：source record {
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/SASDG65.out",
"role": "pddf",
"sha256": "69636e175f3ff0e09a50a2833568cfec9bf6f773ce1533ba53ce321926dc0801",
"size": 56062,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDG65.out"
} sascif：source record {
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/SASDG65.sascif",
"role": "sascif",
"sha256": "fe5f1f71ae1972c329067766e800c35757c2268a5ad107caa8c32cc5fe0fb3f1",
"size": 167073,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG65.sascif"
} summary：source record {
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/summary.json",
"sha256": "81fc0f51907dd9825f5dbaf05d822c3e954f6ee3bc5cc66ad1719404e59c7936",
"size": 8468,
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDG65/"
} All source fields (unfiltered)
Every source field is expanded here, including empty values, list members and fields already shown above.
summary.json：156 field values manifest.json：36 field values View the complete summary.json source {
"code": "SASDG65",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Salt bridges at the subdomain interfaces of the adenylation domain and active-site residues of <i>Mycobacterium tuberculosis</i>\n NAD <sup>+</sup>\n -dependent DNA ligase A (MtbLigA) are important for the initial steps of nick-sealing activity",
"publication": {
"title": "Salt bridges at the subdomain interfaces of the adenylation domain and active-site residues of <i>Mycobacterium tuberculosis</i>\n NAD <sup>+</sup>\n -dependent DNA ligase A (MtbLigA) are important for the initial steps of nick-sealing activity",
"author_list": "Afsar M, Shukla A, Kumar N, Ramachandran R",
"journal": "Acta Crystallographica Section D Structural Biology",
"doi": "10.1107/S2059798321003107",
"pmid": null,
"published_date": "2021 May 14"
},
"status": "released",
"submitted_date": "2019-09-05",
"released_date": "2021-05-18"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDG65.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDG65.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG65_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG65_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG65_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG65_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG65.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Hybrid Photon Counting (HPC)",
"name": "Mythen2 R 1K",
"resolution": null
},
"name": "CSIR-Central Drug Research Institute",
"city": "Lucknow",
"country": "India",
"beamline_name": "Anton Paar SAXSpace",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "DNA ligase A",
"short_name": "AdD",
"sequence": "MSSPDADQTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPELRTPDSPTQLVGGAGFATDF\r\nEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLCELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTI\r\nADVPERLTPGDDYPVPEVLEVRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGH\r\nVEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVKVDEVALQRRLGSTSRAPRWA\r\nIAYKYPPE",
"organism": "Mycobacterium tuberculosis",
"uniprot_code": "P9WNV1",
"uniprot_range_first": 1,
"uniprot_range_last": 328,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSSPDADQTAPEVLRQWQALAEEVREHQFRYYVRDAPIISDAEFDELLRRLEALEEQHPE\nLRTPDSPTQLVGGAGFATDFEPVDHLERMLSLDNAFTADELAAWAGRIHAEVGDAAHYLC\nELKIDGVALSLVYREGRLTRASTRGDGRTGEDVTLNARTIADVPERLTPGDDYPVPEVLE\nVRGEVFFRLDDFQALNASLVEEGKAPFANPRNSAAGSLRQKDPAVTARRRLRMICHGLGH\nVEGFRPATLHQAYLALRAWGLPVSEHTTLATDLAGVRERIDYWGEHRHEVDHEIDGVVVK\nVDEVALQRRLGSTSRAPRWAIAYKYPPEEAQTKLLDIRVNVGRTGRITPFAFMTPVKVAG\nSTVGQATLHNASEIKRKGVLIGDTVVIRKAGDVIPEVLGPVVELRDGSEREFIMPTTCPE\nCGSPLAPEKEGDADIRCPNARGCPGQLRERVFHVASRNGLDIEVLGYEAGVALLQAKVIA\nDEGELFALTERDLLRTDLFRTKAGELSANGKRLLVNLDKAKAAPLWRVLVALSIRHVGPT\nAARALATEFGSLDAIAAASTDQLAAVEGVGPTIAAAVTEWFAVDWHREIVDKWRAAGVRM\nVDERDESVPRTLAGLTIVVTGSLTGFSRDDAKEAIVARGGKAAGSVSKKTNYVVAGDSPG\nSKYDKAVELGVPILDEDGFRRLLADGPASRT",
"mw": 36.729,
"total_mw": 36.729,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Tris-HCl 200 mM NaCl 2mM β-mercaptoethanol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Adenylation domain of DNA ligase A (LigA)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "India",
"full_name": "CSIR - Central Drug Research Institute",
"webpage": "https://cdri.res.in/"
}
],
"contributor_name": "Ravishankar",
"contributor_surname": "Ramachandran",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2019-05-21",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 1800.0,
"number_of_frames": 2,
"wavelength": 0.154,
"sample_detector_distance": 0.31,
"concentration_min": null,
"concentration_max": 12.5,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.131,
"s_max": 4.891,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG65_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG65_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/R4nmn_5.log",
"symmetry": null,
"comment": null,
"user": 328
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDG65_fit1_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 0.02,
"p_value": 0.008344,
"fit_residual_plot": "SASDG65_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG65_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/R4nmn_5.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of the adenylation domain of DNA ligase A in 50 mM Tris-HCl 200 mM NaCl 2 mM β-mercaptoethanol, pH 8 were collected using an Anton Paar SAXSpace at the CSIR-Central Drug Research Institute (Lucknow India) with a Mythen2 R 1K detector at a sample-detector distance of 0.3 m and at a wavelength of λ = 0.154 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 12.50 mg/ml was measured at 10°C. Two successive 1800 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 36.6,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 50840.0,
"pddf_i0_error": null,
"guinier_i0": 51634.0,
"guinier_i0_error": 377.0,
"pddf_rg": 2.684,
"pddf_rg_error": null,
"guinier_rg": 2.73,
"guinier_rg_error": 0.08,
"pddf_dmax": 8.88,
"pddf_dmax_error": null,
"porod_volume": 68.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 3,
"guinier_point_last": 55,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDG65_datloglog_img.png",
"symmetry": null,
"last_modified": "2021-05-18T08:48:43.246132+02:00",
"bragg_peak": []
} View the complete manifest.json source {
"code": "SASDG65",
"status": "success",
"started_at": "2026-08-11T16:36:37.301528+00:00",
"finished_at": "2026-08-11T16:36:45.143525+00:00",
"source_last_modified": "2021-05-18T08:48:43.246132+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDG65/",
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/summary.json",
"size": 8468,
"sha256": "81fc0f51907dd9825f5dbaf05d822c3e954f6ee3bc5cc66ad1719404e59c7936"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDG65.dat",
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/SASDG65.dat",
"size": 34333,
"sha256": "92a788468210e5fe668ab6148f74bf8bfdd011f901e086031a408f91b2c11614",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDG65.out",
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/SASDG65.out",
"size": 56062,
"sha256": "69636e175f3ff0e09a50a2833568cfec9bf6f773ce1533ba53ce321926dc0801",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG65.sascif",
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/SASDG65.sascif",
"size": 167073,
"sha256": "fe5f1f71ae1972c329067766e800c35757c2268a5ad107caa8c32cc5fe0fb3f1",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDG65.zip",
"path": "/data/saxsdb/sasbdb/entries/65/sasdg65/source/SASDG65.zip",
"size": 45388,
"sha256": "6212a3a66c4727770a98a29c3cde3738754f1f293b72fa8df1d9d363c92a8362",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
} 
