The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDG75",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "A highly stable, non-digestible lectin from <i>Pomacea diffusa</i> unveils clade-related protection systems in apple snail eggs.",
"publication": {
"title": "A highly stable, non-digestible lectin from <i>Pomacea diffusa</i> unveils clade-related protection systems in apple snail eggs.",
"author_list": "Brola TR, Dreon MS, Qiu JW, Heras H",
"journal": "J Exp Biol",
"doi": "10.1242/jeb.231878",
"pmid": "32719049",
"published_date": "2020 Oct 8"
},
"status": "released",
"submitted_date": "2019-09-05",
"released_date": "2020-07-17"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDG75.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDG75.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG75_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG75_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG75_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG75_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG75.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "MAR 165 CCD",
"resolution": null
},
"name": "Brazilian Synchrotron Light Laboratory",
"city": "Campinas",
"country": "Brazil",
"beamline_name": "SAXS2 Beamline",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Pomacea diffusa perivitellin-1",
"short_name": "PdPV1",
"sequence": "MFVATSLLLALATLVATVASKDEYLIMEINPPKKVSEQEILNMLSPLEIKHKFRVTGTTKLWIVIKLDPVGYMKLDNITVPGKVSVTPAEDMVDTMQKFGVFWPQASLTEENITLFQSHSYLTDVTKEQLTAMMVGYGEHMVETLKSHPYQFYRATGVTPHKHFFFVSSARDEVEVIGREGVDIWGGPGEYHVKPEYLIRI",
"organism": "Pomacea diffusa",
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "unknown",
"molecular_type": "protein",
"uniprot_sequence": null,
"mw": 22.751,
"total_mw": 22.751,
"number_molecules": 0,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM Phosphate buffer",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Pomacea diffusa perivitellin-1",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [],
"contributor_name": "Marcos",
"contributor_surname": "Dreon",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2015-03-27",
"storage_temperature": null,
"cell_temperature": 25.0,
"exposure_time": 300.0,
"number_of_frames": 5,
"wavelength": 0.155,
"sample_detector_distance": 1.51154,
"concentration_min": null,
"concentration_max": 0.65,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.097,
"s_max": 2.112,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG75_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "dammif (r6669)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG75_fit1_model1.pdb",
"model_mw": 312.0,
"bead_radius": 3.3,
"log": null,
"symmetry": null,
"comment": null,
"user": 128
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDG75_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 6.644,
"p_value": 0.0,
"fit_residual_plot": "SASDG75_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG75_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/geYwhC_2.fit",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG75_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "dammif (r6669)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG75_fit2_model1.pdb",
"model_mw": 312.0,
"bead_radius": 3.3,
"log": null,
"symmetry": null,
"comment": null,
"user": 128
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDG75_fit2_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 6.889,
"p_value": 0.0,
"fit_residual_plot": "SASDG75_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG75_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/geYwhC_3-1.pdb",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG75_fit3_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "dammif (r6669)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG75_fit3_model1.pdb",
"model_mw": 312.0,
"bead_radius": 3.3,
"log": null,
"symmetry": null,
"comment": null,
"user": 128
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDG75_fit3_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 6.906,
"p_value": 0.0,
"fit_residual_plot": "SASDG75_fit3_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG75_fit3.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/geYwhC_4.fit",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.5a",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Pomacea diffusa perivitellin-1 in 50 mM phosphate buffer, pH 7.4 were collected on the SAXS2 beam line at the Brazilian Synchrotron Light Laboratory (Campinas, Brazil) using a MAR 165 CCD detector at a sample-detector distance of 1.5 m and at a wavelength of λ = 0.155 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 0.65 mg/ml was measured at 25°C. Five successive 300 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 465.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.0008577,
"pddf_i0_error": null,
"guinier_i0": 0.000856,
"guinier_i0_error": 1.6e-06,
"pddf_rg": 4.72,
"pddf_rg_error": null,
"guinier_rg": 4.64,
"guinier_rg_error": 0.1,
"pddf_dmax": 15.5,
"pddf_dmax_error": null,
"porod_volume": 529.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 7,
"guinier_point_last": 15,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDG75_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-07-17T09:56:07.777900+02:00",
"bragg_peak": []
}
