The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDG97",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Structures of three MORN repeat proteins and a re-evaluation of the proposed lipid-binding properties of MORN repeats.",
"publication": {
"title": "Structures of three MORN repeat proteins and a re-evaluation of the proposed lipid-binding properties of MORN repeats.",
"author_list": "Sajko S, Grishkovskaya I, Kostan J, Graewert M, Setiawan K, Trübestein L, Niedermüller K, Gehin C, Sponga A, Puchinger M, Gavin AC, Leonard TA, Svergun DI, Smith TK, Morriswood B, Djinovic-Carugo K",
"journal": "PLoS One",
"doi": "10.1371/journal.pone.0242677",
"pmid": "33296386",
"published_date": "2020"
},
"status": "released",
"submitted_date": "2019-10-01",
"released_date": "2020-01-23"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDG97.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDG97.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG97_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG97_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG97_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG97_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG97.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Trypanosoma brucei Membrane Occupation and Recognition Nexus MORN repeats 2-15",
"short_name": "tbMORNdelta1",
"sequence": "MYDGDWVFGKRHGTGVYVYADGSRYEGEWVDDKVHGNGACYYTSGNVYTG\r\nEWSMGRINGRGVLEYHDGDRYEGEWKDGRMHGKGTYCYSNGDKYEGEWKE\r\nDKRHGKGVVVYAAPDGCVSEKYDGEWNEGRMQGWGKYFYADGGVYEGEWV\r\nDGRMHGRGTYVFPNGNKYEGEWVEDRKDGYGILLYTNGERYEGYWHLDKA\r\nHGKGTLTFLQGDRYVGEWHYGKKHGHGVLSYSNGDTYDGEWRDDDAWGYG\r\nVLQYANGCRYEGEWAEDRRHGKGLLVLPDGSSYEGSFAHGKKDGPGKIIL\r\nKDGSMYIGTWKDGVIVGQGEFRLSENCDLSNPDYSAWSHPQFEK",
"organism": "Trypanosoma brucei",
"uniprot_code": "Q587D3",
"uniprot_range_first": 26,
"uniprot_range_last": 358,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MIYSGEIENGQMHGRGCLQYPNKEKYDGDWVFGKRHGTGVYVYADGSRYEGEWVDDKVHG\nNGACYYTSGNVYTGEWSMGRINGRGVLEYHDGDRYEGEWKDGRMHGKGTYCYSNGDKYEG\nEWKEDKRHGKGVVVYAAPDGCVSEKYDGEWNEGRMQGWGKYFYADGGVYEGEWVDGRMHG\nRGTYVFPNGNKYEGEWVEDRKDGYGILLYTNGERYEGYWHLDKAHGKGTLTFLQGDRYVG\nEWHYGKKHGHGVLSYSNGDTYDGEWRDDDAWGYGVLQYANGCRYEGEWAEDRRHGKGLLV\nLPDGSSYEGSFAHGKKDGPGKIILKDGSMYIGTWKDGVIVGQGEFRLSENCDLSNPDY",
"mw": 39.15,
"total_mw": 78.3,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris-HCl, 100 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Trypanosoma brucei Membrane Occupation and Recognition Nexus MORN1 repeats 2-15",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Melissa ",
"contributor_surname": "Graewert",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-01-27",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 90,
"wavelength": 0.099,
"sample_detector_distance": 2.867,
"concentration_min": null,
"concentration_max": 3.8,
"sample_volume": 100.0,
"flow_rate": 0.5,
"s_min": 0.101,
"s_max": 4.942,
"total_exposure_time": null,
"seccolumn": 1
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG97_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG97_fit1_model1.pdb",
"model_mw": 60.7,
"bead_radius": 2.1,
"log": null,
"symmetry": "P2",
"comment": null,
"user": 14
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDG97_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 0.866,
"p_value": 0.045772,
"fit_residual_plot": "SASDG97_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG97_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/dji_tb_d_1_6.log",
"software_version": null,
"description": "20 runs of Dammif. This model was selected by Damsel."
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDG97_fit2_model1_img.png",
"software": "Custom in-house",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDG97_fit2_model1.pdb",
"model_mw": 74.23,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 14
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDG97_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 2.201,
"p_value": 0.0,
"fit_residual_plot": "SASDG97_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDG97_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 74.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 56.63,
"pddf_i0_error": null,
"guinier_i0": 54.21,
"guinier_i0_error": 0.13,
"pddf_rg": 7.31,
"pddf_rg_error": null,
"guinier_rg": 6.46,
"guinier_rg_error": 0.57,
"pddf_dmax": 26.0,
"pddf_dmax_error": null,
"porod_volume": 187.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 10,
"guinier_point_last": 19,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDG97_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-01-23T10:37:42.237721+01:00",
"bragg_peak": []
}
