The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDGB7",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Structures of three MORN repeat proteins and a re-evaluation of the proposed lipid-binding properties of MORN repeats.",
"publication": {
"title": "Structures of three MORN repeat proteins and a re-evaluation of the proposed lipid-binding properties of MORN repeats.",
"author_list": "Sajko S, Grishkovskaya I, Kostan J, Graewert M, Setiawan K, Trübestein L, Niedermüller K, Gehin C, Sponga A, Puchinger M, Gavin AC, Leonard TA, Svergun DI, Smith TK, Morriswood B, Djinovic-Carugo K",
"journal": "PLoS One",
"doi": "10.1371/journal.pone.0242677",
"pmid": "33296386",
"published_date": "2020"
},
"status": "released",
"submitted_date": "2019-10-01",
"released_date": "2020-01-23"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDGB7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDGB7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGB7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGB7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/tg_d6_sec_510_cut_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGB7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGB7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Toxoplasma gondii Membrane Occupation and Recognition Nexus (MORN1) repeats 7-15",
"short_name": "tg MORN1 delta6",
"sequence": "EKYEGDWVNGKMHGHGKYIYSDGGVYEGDWIDGKMHGKGTYVFPNGNVYEGE\r\nWAHDMKDGYGVLTYQNGEKYEGYWKQDKVHGKGTLTYTRGDKYIGDWMDAKK\r\nDGEGELIYANGDRFKGQWADDRANGFGVFTYANGNRYEGEWTDDKRHGRGVFY\r\nCAEDGSAYEGEFVGGRKEGNGILRLATGHQLEGTWSGGQLVRV\r\nTSFVFAQDSPWLNVDL",
"organism": "Toxoplasma gondii",
"uniprot_code": "A0A0F7VBC6",
"uniprot_range_first": 48,
"uniprot_range_last": 363,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MESCHAYHGQIKDGLFHGKGTLIYSGNEKYEGEFVFGKREGHGRFLYADGATYEGKWVED\nRIHGQGVAHFASGNRYEGQWEMGRINGFGKLSYSNGDEYEGEWVDGKMHGRGTYRYAEGD\nVYTGEWRDDKRHGKGSVTYVSAKGSVVEKYEGDWVNGKMHGHGKYIYSDGGVYEGDWIDG\nKMHGKGTYVFPNGNVYEGEWAHDMKDGYGVLTYQNGEKYEGYWKQDKVHGKGTLTYTRGD\nKYIGDWMDAKKDGEGELIYANGDRFKGQWADDRANGFGVFTYANGNRYEGEWTDDKRHGR\nGVFYCAEDGSAYEGEFVGGRKEGNGILRLATGHQLEGTWSGGQLVRVTSFVFAQDSPWLN\nVDL",
"mw": 24.358,
"total_mw": 48.716,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris-HCl, 100 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Toxoplasma gondii Membrane Occupation and Recognition Nexus (MORN1) repeats 7-15",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Melissa ",
"contributor_surname": "Graewert",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-06-10",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 6,
"wavelength": 0.12,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 2.6,
"sample_volume": 100.0,
"flow_rate": 0.5,
"s_min": 0.08,
"s_max": 4.385,
"total_exposure_time": null,
"seccolumn": 1
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGB7_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "SUPCOMB 23 (r9988)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDGB7_fit1_model1.pdb",
"model_mw": 29.254,
"bead_radius": 4.3,
"log": null,
"symmetry": null,
"comment": null,
"user": 14
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGB7_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.068,
"p_value": 0.002621,
"fit_residual_plot": "SASDGB7_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGB7_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/run_5_vvVRbQO.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGB7_fit2_model1_img.png",
"software": "Custom in-house",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDGB7_fit2_model1.pdb",
"model_mw": 46.83,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 14
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGB7_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.321,
"p_value": 0.0,
"fit_residual_plot": "SASDGB7_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGB7_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 50.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 33.0,
"porod_mw_error": null,
"pddf_i0": 4844.0,
"pddf_i0_error": null,
"guinier_i0": 4757.14,
"guinier_i0_error": 11.08,
"pddf_rg": 4.34,
"pddf_rg_error": null,
"guinier_rg": 4.0,
"guinier_rg_error": 0.03,
"pddf_dmax": 17.0,
"pddf_dmax_error": null,
"porod_volume": 55.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 2,
"guinier_point_last": 90,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDGB7_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}
