The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDGC6",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "The structural basis of fungal glucuronoyl esterase activity on natural substrates.",
"publication": {
"title": "The structural basis of fungal glucuronoyl esterase activity on natural substrates.",
"author_list": "Ernst HA, Mosbech C, Langkilde AE, Westh P, Meyer AS, Agger JW, Larsen S",
"journal": "Nat Commun",
"doi": "10.1038/s41467-020-14833-9",
"pmid": "32094331",
"published_date": "2020 Feb 24"
},
"status": "released",
"submitted_date": "2019-09-27",
"released_date": "2020-02-28"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDGC6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDGC6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGC6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGC6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDGC6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGC6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGC6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "pixel counting",
"name": "Pilatus3 R 300K",
"resolution": 172.0
},
"name": "University of Copenhagen, Department of Drug Design and Pharmacology",
"city": "Copenhagen",
"country": "Denmark",
"beamline_name": "Xenocs BioXolver L with GeniX3D",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "4-O-methyl-glucuronoyl methylesterase (Glucuronoyl esterase)",
"short_name": "CuGE",
"sequence": ">FL_CuGE/1-481\r\nMQASAPQWGQCGGIGWTGPTACPSGWACQQLNAYYSQCLQGAAPAPARTTAAPPPPPATTAAPPPPTTSAPT\r\nGSSPVAGACGAIASTVPNYNNAKLPDPFTFANGTALRTKADWSCRRAEISALIQNYEAGTLPPKPPVVTASF\r\nSKSGNTGTLAITAGLSNSQTIKFSPTISYPSGTPPANGWPLIIAYEGGSIPIPAGVATLTYSNSDMAQQNSA\r\nSSRGQGLFYQLYGSTHSASAMTAWVWGVSRIIDALEMTPTAQINTQRIGVTGCSRDGKGALMAGAFEERIAL\r\nTIPQESGSGGDACWRLSKYEIDNGNQVQDAVEIVGENVWFSTNFNNYVQKLPTVPEDHHLLAAMVAPRAMIS\r\nFENTDYLWLSPMSSFGCMTAAHTVWQGLGIADSHGFAQVGGHAHCAWPSSLTPQLNAFINRFLLDQSATTNV\r\nFTTNNQFGKVQWNAANWITWTTPTLTGLEQKLISEEDLNSAVDHHHHHH",
"organism": "Cerrena unicolor",
"uniprot_code": "A0A0A7EQR3",
"uniprot_range_first": 18,
"uniprot_range_last": 474,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MFKPSFVALALVSYATAQASAPQWGQCGGIGWTGPTACPSGWACQQLNAYYSQCLQGAAP\nAPARTTAAPPPPPATTAAPPPPTTSAPTGSSPVAGACGAIASTVPNYNNAKLPDPFTFAN\nGTALRTKADWSCRRAEISALIQNYEAGTLPPKPPVVTASFSKSGNTGTLAITAGLSNSQT\nIKFSPTISYPSGTPPANGWPLIIAYEGGSIPIPAGVATLTYSNSDMAQQNSASSRGQGLF\nYQLYGSTHSASAMTAWVWGVSRIIDALEMTPTAQINTQRIGVTGCSRDGKGALMAGAFEE\nRIALTIPQESGSGGDACWRLSKYEIDNGNQVQDAVEIVGENVWFSTNFNNYVQKLPTVPE\nDHHLLAAMVAPRAMISFENTDYLWLSPMSSFGCMTAAHTVWQGLGIADSHGFAQVGGHAH\nCAWPSSLTPQLNAFINRFLLDQSATTNVFTTNNQFGKVQWNAANWITWTTPTLT",
"mw": 50.907,
"total_mw": 50.907,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM sodium acetate",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 5.0,
"deuteration": null
},
"purity_method": null,
"name": "Glucuronoyl esterase, deglycolsylated full length",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Copenhagen, Denmark",
"full_name": "University of Copenhagen",
"webpage": "http://www.ku.dk/"
}
],
"contributor_name": "Annette",
"contributor_surname": "Langkilde",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-10-10",
"storage_temperature": 21.0,
"cell_temperature": 21.0,
"exposure_time": 60.0,
"number_of_frames": 10,
"wavelength": 0.154,
"sample_detector_distance": 0.571,
"concentration_min": null,
"concentration_max": 3.7,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.197,
"s_max": 4.805,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGC6_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDGC6_fit1_model1.pdb",
"model_mw": 46.714,
"bead_radius": 2.25,
"log": "https://www.sasbdb.org/media/log_files/sub_012.log",
"symmetry": "P1",
"comment": null,
"user": 42
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGC6_fit1_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.109,
"p_value": 0.774734,
"fit_residual_plot": "SASDGC6_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGC6_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/sub_012.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGC6_fit2_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDGC6_fit2_model1.pdb",
"model_mw": null,
"bead_radius": 1.9,
"log": "https://www.sasbdb.org/media/log_files/sub012-gasbori.log",
"symmetry": "P1",
"comment": null,
"user": 42
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGC6_fit2_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 1.17,
"p_value": 0.00215,
"fit_residual_plot": "SASDGC6_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGC6_fit2.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/sub012-gasbori.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of full-length deglycolsylated glucuronoyl esterase in 20 mM sodium acetate, pH 5 were collected using a Xenocs BioXolver L with GeniX3D (University of Copenhagen, Department of Drug Design and Pharmacology) equipped with a Pilatus3 R 300K detector at a sample-detector distance of 0.6 m and at a wavelength of λ = 0.154 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.70 mg/ml was measured at 21°C. 10 successive 60 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 45.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 44.0,
"porod_mw_error": null,
"pddf_i0": 0.05964,
"pddf_i0_error": null,
"guinier_i0": 0.062,
"guinier_i0_error": 0.00093,
"pddf_rg": 3.19,
"pddf_rg_error": null,
"guinier_rg": 3.19,
"guinier_rg_error": 0.29,
"pddf_dmax": 11.0,
"pddf_dmax_error": null,
"porod_volume": 71.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 2,
"guinier_point_last": 18,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDGC6_datloglog_img.png",
"symmetry": null,
"last_modified": "2020-11-03T10:09:09.624639+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDGC6",
"status": "success",
"started_at": "2026-08-11T15:06:16.945258+00:00",
"finished_at": "2026-08-11T15:06:25.265098+00:00",
"source_last_modified": "2020-11-03T10:09:09.624639+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDGC6/",
"path": "/data/saxsdb/sasbdb/entries/c6/sasdgc6/source/summary.json",
"size": 9243,
"sha256": "4975cc17f90a9726d2b800edf4a177807797aaba4d8a145a4f844988ea76133a"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDGC6.dat",
"path": "/data/saxsdb/sasbdb/entries/c6/sasdgc6/source/SASDGC6.dat",
"size": 17010,
"sha256": "2a303b5d52f7b4f4d3755962650fd43e67748a574a5fd187a8fe7c3198304c38",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDGC6.out",
"path": "/data/saxsdb/sasbdb/entries/c6/sasdgc6/source/SASDGC6.out",
"size": 22062,
"sha256": "ed471ee710042b1e5862f71696687153c3469c6e1ca97199be9219ad46b6a394",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGC6.sascif",
"path": "/data/saxsdb/sasbdb/entries/c6/sasdgc6/source/SASDGC6.sascif",
"size": 289731,
"sha256": "68bb7d20bc8d383733c4cfaf71d9b48316ff0e8dd422ea6bc99ac4eff2656d9f",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDGC6.zip",
"path": "/data/saxsdb/sasbdb/entries/c6/sasdgc6/source/SASDGC6.zip",
"size": 46418,
"sha256": "4d16c575047596a726893f7845d0d2c6640b98d7ffd02fe7271520130247b2e5",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
