The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDGD2",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Structural properties of [2Fe-2S] ISCA2-IBA57: a complex of the mitochondrial iron-sulfur cluster assembly machinery",
"publication": {
"title": "Structural properties of [2Fe-2S] ISCA2-IBA57: a complex of the mitochondrial iron-sulfur cluster assembly machinery",
"author_list": "Nasta V, Da Vela S, Gourdoupis S, Ciofi-Baffoni S, Svergun D, Banci L",
"journal": "Scientific Reports",
"doi": "10.1038/s41598-019-55313-5",
"pmid": null,
"published_date": "2019 Dec 12"
},
"status": "released",
"submitted_date": "2019-07-22",
"released_date": "2019-12-07"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDGD2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDGD2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGD2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGD2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDGD2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGD2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGD2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Putative transferase CAF17, mitochondrial",
"short_name": "IBA57",
"sequence": "AGAAWACFRLDGRTLLRVRGPDAAPFLLGLLTNELPLPSPAAAGAPPAARAGYAHFLNVQGRTLYDVILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVWAVLPSSPEACGAASLQERAGAAAILIRDPRTARMGWRLLTQDEGPALVPGGRLGDLWDYHQHRYLQGVPEGVRDLPPGVALPLESNLAFMNGVSFTKGCYIGQELTARTHHMGVIRKRLFPVRFLDPLPTSGITPGATVLTASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRASEGAQVALAASVPDWWP",
"organism": "Homo sapiens",
"uniprot_code": "Q5T440",
"uniprot_range_first": 44,
"uniprot_range_last": 352,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MATAALLRGATPGRGGPVWRWRLRAAPRCRLAHSSCSPGGDPTAGAAWACFRLDGRTLLR\nVRGPDAAPFLLGLLTNELPLPSPAAAGAPPAARAGYAHFLNVQGRTLYDVILYGLQEHSE\nVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVWAVLPSSPEACGAASLQERAG\nAAAILIRDPRTARMGWRLLTQDEGPALVPGGRLGDLWDYHQHRYLQGVPEGVRDLPPGVA\nLPLESNLAFMNGVSFTKGCYIGQELTARTHHMGVIRKRLFPVRFLDPLPTSGITPGATVL\nTASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRASEGAQVALAASVPDWWPTVSK",
"mw": 33.242,
"total_mw": 33.242,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "50 mM phosphate, 150 mM NaCl, 5 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.0,
"deuteration": null
},
"purity_method": null,
"name": "Putative mitochondrial transferase CAF17: human IBA57",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Stefano",
"contributor_surname": "Da Vela",
"orcid": "https://orcid.org/0000-0002-1700-4759"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-07-10",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.995,
"number_of_frames": 3000,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 5.0,
"sample_volume": 100.0,
"flow_rate": 0.5,
"s_min": 0.123,
"s_max": 3.696,
"total_exposure_time": null,
"seccolumn": 1
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGD2_fit1_model1_img.png",
"software": "PDB (Protein Data Bank)",
"pdb_link": [
{
"pdb_code": "6qe3",
"ext_code": "6QE3",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDGD2_fit1_model1.pdb",
"model_mw": 33.23,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 471
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGD2_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.075,
"p_value": 0.0758,
"fit_residual_plot": "SASDGD2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGD2_fit1.fit",
"fit_log": null,
"software_version": "2.8.3",
"description": "Putative mitochondrial transferase CAF17: human IBA57"
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of human IBA57 in 50 mM phosphate, 150 mM NaCl, 5 mM DTT, pH 7 were collected on the EMBL P12 beam line at the PETRA III storage ring (Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 100.00 μl sample at 5 mg/ml was injected at a 0.50 ml/min flow rate onto a GE Superdex 200 Increase 10/300 column at 20°C. 3000 successive 0.995 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 25.6,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 31.0,
"porod_mw_error": null,
"pddf_i0": 177.3,
"pddf_i0_error": null,
"guinier_i0": 177.0,
"guinier_i0_error": 0.39,
"pddf_rg": 2.172,
"pddf_rg_error": null,
"guinier_rg": 2.16,
"guinier_rg_error": 0.015,
"pddf_dmax": 7.14,
"pddf_dmax_error": null,
"porod_volume": 50.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 3,
"guinier_point_last": 174,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDGD2_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:55:24.740692+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDGD2",
"status": "success",
"started_at": "2026-08-11T13:36:03.888862+00:00",
"finished_at": "2026-08-11T13:36:18.176516+00:00",
"source_last_modified": "2023-06-21T07:55:24.740692+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDGD2/",
"path": "/data/saxsdb/sasbdb/entries/d2/sasdgd2/source/summary.json",
"size": 8130,
"sha256": "4de67ba01a8438a9ad4d686741d53a5e92ef1811e349194ce253b069f86af9d8"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDGD2.dat",
"path": "/data/saxsdb/sasbdb/entries/d2/sasdgd2/source/SASDGD2.dat",
"size": 61048,
"sha256": "1d0bc574dec5cda1956706208299c238548f276f098d413d4e9d8dad3148da53",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDGD2.out",
"path": "/data/saxsdb/sasbdb/entries/d2/sasdgd2/source/SASDGD2.out",
"size": 112424,
"sha256": "4c4f3bb5ca9ac5de51522a2eba09ed24c6a6a66c6bee1563bcce27e1da5b1afc",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGD2.sascif",
"path": "/data/saxsdb/sasbdb/entries/d2/sasdgd2/source/SASDGD2.sascif",
"size": 691910,
"sha256": "7db290229c2bf7bbcb152e58e7716081c9449635325a745ed14bdf1b10745451",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDGD2.zip",
"path": "/data/saxsdb/sasbdb/entries/d2/sasdgd2/source/SASDGD2.zip",
"size": 222113,
"sha256": "eadd5c96f7ac2f575e731f44cdde4d3a04a028711078814807eae989daab5d6d",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
