Glucuronoyl esterase S286A, deglycolsylated truncated (amino acids 95-474)

{
  "code": "SASDGD6",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "The structural basis of fungal glucuronoyl esterase activity on natural substrates.",
    "publication": {
      "title": "The structural basis of fungal glucuronoyl esterase activity on natural substrates.",
      "author_list": "Ernst HA, Mosbech C, Langkilde AE, Westh P, Meyer AS, Agger JW, Larsen S",
      "journal": "Nat Commun",
      "doi": "10.1038/s41467-020-14833-9",
      "pmid": "32094331",
      "published_date": "2020 Feb 24"
    },
    "status": "released",
    "submitted_date": "2019-09-27",
    "released_date": "2020-02-28"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDGD6.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDGD6.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGD6_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGD6_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDGD6_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGD6_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGD6.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "pixel counting",
        "name": "Pilatus3 R 300K",
        "resolution": 172.0
      },
      "name": "University of Copenhagen, Department of Drug Design and Pharmacology",
      "city": "Copenhagen",
      "country": "Denmark",
      "beamline_name": "Xenocs BioXolver L with GeniX3D",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "4-O-methyl-glucuronoyl methylesterase (Glucuronoyl esterase, truncated)",
          "short_name": "CuGE",
          "sequence": ">dDeltaS270A/95-474 + extra N-term seq from plasmid\r\nEAEAEFGACGAIASTVPNYNNAKLPDPFTFANGTALRTKADWSCRRAEISALIQNYEAGTLPPKPPVVTASF\r\nSKSGNTGTLAITAGLSNSQTIKFSPTISYPSGTPPANGWPLIIAYEGGSIPIPAGVATLTYSNSDMAQQNSA\r\nSSRGQGLFYQLYGSTHSASAMTAWVWGVSRIIDALEMTPTAQINTQRIGVTGCARDGKGALMAGAFEERIAL\r\nTIPQESGSGGDACWRLSKYEIDNGNQVQDAVEIVGENVWFSTNFNNYVQKLPTVPEDHHLLAAMVAPRAMIS\r\nFENTDYLWLSPMSSFGCMTAAHTVWQGLGIADSHGFAQVGGHAHCAWPSSLTPQLNAFINRFLLDQSATTNV\r\nFTTNNQFGKVQWNAANWITWTTPTLTENLYFQGVDHHHHHH",
          "organism": "Cerrena unicolor",
          "uniprot_code": "A0A0A7EQR3",
          "uniprot_range_first": 95,
          "uniprot_range_last": 474,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MFKPSFVALALVSYATAQASAPQWGQCGGIGWTGPTACPSGWACQQLNAYYSQCLQGAAP\nAPARTTAAPPPPPATTAAPPPPTTSAPTGSSPVAGACGAIASTVPNYNNAKLPDPFTFAN\nGTALRTKADWSCRRAEISALIQNYEAGTLPPKPPVVTASFSKSGNTGTLAITAGLSNSQT\nIKFSPTISYPSGTPPANGWPLIIAYEGGSIPIPAGVATLTYSNSDMAQQNSASSRGQGLF\nYQLYGSTHSASAMTAWVWGVSRIIDALEMTPTAQINTQRIGVTGCSRDGKGALMAGAFEE\nRIALTIPQESGSGGDACWRLSKYEIDNGNQVQDAVEIVGENVWFSTNFNNYVQKLPTVPE\nDHHLLAAMVAPRAMISFENTDYLWLSPMSSFGCMTAAHTVWQGLGIADSHGFAQVGGHAH\nCAWPSSLTPQLNAFINRFLLDQSATTNVFTTNNQFGKVQWNAANWITWTTPTLT",
          "mw": 43.178,
          "total_mw": 43.178,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM sodium acetate",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 5.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Glucuronoyl esterase S286A, deglycolsylated truncated (amino acids 95-474)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Copenhagen, Denmark",
            "full_name": "University of Copenhagen",
            "webpage": "http://www.ku.dk/"
          }
        ],
        "contributor_name": "Annette",
        "contributor_surname": "Langkilde",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-10-10",
    "storage_temperature": 21.0,
    "cell_temperature": 21.0,
    "exposure_time": 60.0,
    "number_of_frames": 10,
    "wavelength": 0.154,
    "sample_detector_distance": 0.571,
    "concentration_min": null,
    "concentration_max": 3.6,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.197,
    "s_max": 4.805,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGD6_fit1_model1_img.png",
          "software": "PDB (Protein Data Bank)",
          "pdb_link": [
            {
              "pdb_code": "6rtv",
              "ext_code": "6RTV",
              "ext_type": "pdb",
              "difference_with_model": "identical"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDGD6_fit1_model1.pdb",
          "model_mw": null,
          "bead_radius": null,
          "log": null,
          "symmetry": "P1",
          "comment": null,
          "user": 42
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGD6_fit1_fixed_fit_img.png",
      "software": "CRYSOL",
      "chi_square_value": 1.054,
      "p_value": 0.011142,
      "fit_residual_plot": "SASDGD6_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGD6_fit1.fit",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/dD_A.log",
      "software_version": "2.8.3",
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of N-terminal truncated mutant glucuronoyl esterase (S286A, deglycolsylated) in 20 mM sodium acetate, pH 5 were collected using a Xenocs BioXolver L with GeniX3D (University of Copenhagen, Department of Drug Design and Pharmacology) equipped with a Pilatus3 R 300K detector at a sample-detector distance of 0.6 m and at a wavelength of λ = 0.154 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.60 mg/ml was measured at 21°C. 10 successive 60 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 35.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 31.0,
  "porod_mw_error": null,
  "pddf_i0": 0.03734,
  "pddf_i0_error": null,
  "guinier_i0": 0.037,
  "guinier_i0_error": null,
  "pddf_rg": 2.05,
  "pddf_rg_error": null,
  "guinier_rg": 2.01,
  "guinier_rg_error": 0.08,
  "pddf_dmax": 6.06,
  "pddf_dmax_error": null,
  "porod_volume": 49.5,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 3,
  "guinier_point_last": 37,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDGD6_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-11-03T10:09:23.500227+01:00",
  "bragg_peak": []
}

{
  "code": "SASDGD6",
  "status": "success",
  "started_at": "2026-08-11T15:06:55.708387+00:00",
  "finished_at": "2026-08-11T15:07:07.979602+00:00",
  "source_last_modified": "2020-11-03T10:09:23.500227+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDGD6/",
      "path": "/data/saxsdb/sasbdb/entries/d6/sasdgd6/source/summary.json",
      "size": 8275,
      "sha256": "bba4fcde52461f89fbfba52d99675d211592bffa3584e8f530dbe27cda66e1b3"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDGD6.dat",
      "path": "/data/saxsdb/sasbdb/entries/d6/sasdgd6/source/SASDGD6.dat",
      "size": 17010,
      "sha256": "52f4265ccdbbf5945182e038859e74afc101f4bd802d95f75b18590141f3a90c",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDGD6.out",
      "path": "/data/saxsdb/sasbdb/entries/d6/sasdgd6/source/SASDGD6.out",
      "size": 32404,
      "sha256": "38d5b960307c412520365f81ad62c88d26e8c247a4c0bd8125a3dbb3ed796c1a",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGD6.sascif",
      "path": "/data/saxsdb/sasbdb/entries/d6/sasdgd6/source/SASDGD6.sascif",
      "size": 352749,
      "sha256": "8c1ed2188b5b063acf9552f40e9c9297138abe78fa41bfa80fae797db7f489b4",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDGD6.zip",
      "path": "/data/saxsdb/sasbdb/entries/d6/sasdgd6/source/SASDGD6.zip",
      "size": 79267,
      "sha256": "17ac03d652a108fabc14e0b978bd6f826eaaeddfe4c26955243ad3480b1ab1b1",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}