Interleukin 11 receptor subunit alpha

{
  "code": "SASDGG2",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "The structure of the extracellular domains of human interleukin 11 α-receptor reveals mechanisms of cytokine engagement",
    "publication": {
      "title": "The structure of the extracellular domains of human interleukin 11 α-receptor reveals mechanisms of cytokine engagement",
      "author_list": "Metcalfe R, Aizel K, Zlatic C, Nguyen P, Morton C, Lio D, Cheng H, Dobson R, Parker M, Gooley P, Putoczki T, Griffin M",
      "journal": "Journal of Biological Chemistry",
      "doi": "10.1074/jbc.RA119.012351",
      "pmid": null,
      "published_date": "2020 Apr 24"
    },
    "status": "released",
    "submitted_date": "2019-07-24",
    "released_date": "2020-04-25"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDGG2.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDGG2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGG2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGG2_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDGG2_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGG2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGG2.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 S 2M",
        "resolution": 172.0
      },
      "name": "Australian Synchrotron",
      "city": "Melbourne",
      "country": "Australia",
      "beamline_name": "SAXS/WAXS",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Interleukin-11 receptor subunit alpha",
          "short_name": "IL11RA",
          "sequence": "GSSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHEL\r\nVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAAR\r\nCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPSQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEV\r\nITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGT",
          "organism": "Homo sapiens",
          "uniprot_code": "Q14626",
          "uniprot_range_first": 23,
          "uniprot_range_last": 319,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF\nRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC\nQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC\nVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW\nTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD\nAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHR\nDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP\nNL",
          "mw": 32.179,
          "total_mw": 32.179,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "20 mM Tris, 150 mM NaCl, 0.2% sodium azide",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Interleukin 11 receptor subunit alpha",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Melbourne, Australia",
            "full_name": "Bio21 Institute, The University of Melbourne",
            "webpage": "http://www.bio21.unimelb.edu.au/"
          }
        ],
        "contributor_name": "Riley D.",
        "contributor_surname": "Metcalfe",
        "orcid": "https://orcid.org/0000-0002-7154-780X"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2019-06-08",
    "storage_temperature": null,
    "cell_temperature": 20.0,
    "exposure_time": 1.0,
    "number_of_frames": 6,
    "wavelength": 0.1078,
    "sample_detector_distance": 2.539,
    "concentration_min": null,
    "concentration_max": 2.65,
    "sample_volume": null,
    "flow_rate": 0.45,
    "s_min": 0.059,
    "s_max": 5.341,
    "total_exposure_time": null,
    "seccolumn": 2
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGG2_fit1_model1_img.png",
          "software": "PDB (Protein Data Bank)",
          "pdb_link": [
            {
              "pdb_code": "6o4p",
              "ext_code": "6O4P",
              "ext_type": "pdb",
              "difference_with_model": "derived"
            }
          ],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDGG2_fit1_model1.pdb",
          "model_mw": 32.65,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": "Chain A of PDB model, residues 2-297, corresponding to residues present in the protein used.",
          "user": 380
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGG2_fit1_fixed_fit_img.png",
      "software": "CRYSOL",
      "chi_square_value": 1.032,
      "p_value": 0.481319,
      "fit_residual_plot": "SASDGG2_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGG2_fit1.fit",
      "fit_log": null,
      "software_version": "2.8.3",
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of the alpha subunit of the interleukin 11 receptor in 20 mM Tris, 150 mM NaCl, 0.2% sodium azide, pH 8.5 were collected on the SAXS/WAXS beam line at the Australian Synchrotron (Melbourne, Australia) using a Dectris/Pilatus3 S 2M detector at a sample-detector distance of 2.5 m and at a wavelength of λ = 0.1078 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A sample at 2.7 mg/ml was injected at a 0.45 ml/min flow rate onto a GE Superdex 200 Increase 5/150 column at 20°C. Six successive 1 second frames were collected through the SEC elution peak of the sample. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 33.5,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 25.0,
  "porod_mw_error": null,
  "pddf_i0": 0.01064,
  "pddf_i0_error": null,
  "guinier_i0": 0.01059,
  "guinier_i0_error": 6.7e-05,
  "pddf_rg": 3.1,
  "pddf_rg_error": null,
  "guinier_rg": 3.016,
  "guinier_rg_error": 0.032,
  "pddf_dmax": 9.5,
  "pddf_dmax_error": null,
  "porod_volume": 40.6,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 4,
  "guinier_point_last": 48,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDGG2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2021-03-31T18:37:16.371900+02:00",
  "bragg_peak": []
}

{
  "code": "SASDGG2",
  "status": "success",
  "started_at": "2026-08-11T13:38:10.473432+00:00",
  "finished_at": "2026-08-11T13:38:19.165129+00:00",
  "source_last_modified": "2021-03-31T18:37:16.371900+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDGG2/",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdgg2/source/summary.json",
      "size": 8320,
      "sha256": "bb026a885c0aa273388e87ab1d73e3548959af684ad0f4e01ea776bda1daf409"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDGG2.dat",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdgg2/source/SASDGG2.dat",
      "size": 25751,
      "sha256": "16a16bbf3698dc68e267447de2422868086b23b5284526c9aa4888763b11eef1",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDGG2.out",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdgg2/source/SASDGG2.out",
      "size": 27329,
      "sha256": "fd0996c0b029bd268aeb81fcee828eed133e2940194b69859f3c6125ac9cb747",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGG2.sascif",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdgg2/source/SASDGG2.sascif",
      "size": 327075,
      "sha256": "3280d9f1c39a9dd0d409a4a4b831cfa12f02a098d6db7a6a1ea20f42a80ab8c4",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDGG2.zip",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdgg2/source/SASDGG2.zip",
      "size": 77624,
      "sha256": "832cc49f33be204e131823fe2f89691f9cf6c3ad2884c74ffdce3083551e970b",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}