The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDGK2",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "The structure of the extracellular domains of human interleukin 11 α-receptor reveals mechanisms of cytokine engagement",
"publication": {
"title": "The structure of the extracellular domains of human interleukin 11 α-receptor reveals mechanisms of cytokine engagement",
"author_list": "Metcalfe R, Aizel K, Zlatic C, Nguyen P, Morton C, Lio D, Cheng H, Dobson R, Parker M, Gooley P, Putoczki T, Griffin M",
"journal": "Journal of Biological Chemistry",
"doi": "10.1074/jbc.RA119.012351",
"pmid": null,
"published_date": "2020 Apr 24"
},
"status": "released",
"submitted_date": "2019-07-24",
"released_date": "2020-04-25"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDGK2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDGK2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGK2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGK2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDGK2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDGK2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDGK2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 S 2M",
"resolution": 172.0
},
"name": "Australian Synchrotron",
"city": "Melbourne",
"country": "Australia",
"beamline_name": "SAXS/WAXS",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Interleukin-11 receptor subunit alpha",
"short_name": "IL11RA",
"sequence": "GSSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHEL\r\nVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAAR\r\nCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPSQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEV\r\nITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGT",
"organism": "Homo sapiens",
"uniprot_code": "Q14626",
"uniprot_range_first": 23,
"uniprot_range_last": 319,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF\nRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC\nQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC\nVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW\nTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD\nAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHR\nDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP\nNL",
"mw": 32.179,
"total_mw": 32.179,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "Interleukin 11",
"short_name": "IL11",
"sequence": "GSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL",
"organism": "Homo sapiens",
"uniprot_code": "A8K3F7",
"uniprot_range_first": 32,
"uniprot_range_last": 199,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL\nRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK\nTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG\nLHLTLDWAVRGLLLLKTRL",
"mw": 18.249,
"total_mw": 18.249,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Tris, 150 mM NaCl, 0.2% sodium azide",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.5,
"deuteration": null
},
"purity_method": null,
"name": "Interleukin 11/Interleukin 11 receptor alpha complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Melbourne, Australia",
"full_name": "Bio21 Institute, The University of Melbourne",
"webpage": "http://www.bio21.unimelb.edu.au/"
}
],
"contributor_name": "Riley D.",
"contributor_surname": "Metcalfe",
"orcid": "https://orcid.org/0000-0002-7154-780X"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2019-06-08",
"storage_temperature": null,
"cell_temperature": 20.0,
"exposure_time": 1.0,
"number_of_frames": 6,
"wavelength": 0.1078,
"sample_detector_distance": 2.539,
"concentration_min": null,
"concentration_max": 2.2,
"sample_volume": 50.0,
"flow_rate": 0.45,
"s_min": 0.059,
"s_max": 5.341,
"total_exposure_time": null,
"seccolumn": 2
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGK2_fit1_model1_img.png",
"software": "Other",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDGK2_fit1_model1.pdb",
"model_mw": 49.13,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Model generated using RosettaDock server.",
"user": 380
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGK2_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.074,
"p_value": 0.734138,
"fit_residual_plot": "SASDGK2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGK2_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDGK2_fit2_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDGK2_fit2_model1.pdb",
"model_mw": 62.155,
"bead_radius": 2.75,
"log": null,
"symmetry": null,
"comment": null,
"user": 380
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDGK2_fit2_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.035,
"p_value": 0.963479,
"fit_residual_plot": "SASDGK2_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDGK2_fit2.fir",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of the interleukin 11/interleukin 11 receptor alpha complex in 20 mM Tris, 150 mM NaCl, 0.2% sodium azide, pH 8.5 were collected on the SAXS/WAXS beam line at the Australian Synchrotron (Melbourne, Australia) using a Dectris/Pilatus3 S 2M detector at a sample-detector distance of 2.5 m and at a wavelength of λ = 0.1078 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 50.00 μl sample at 2.2 mg/ml was injected at a 0.45 ml/min flow rate onto a GE Superdex 200 Increase 5/150 column at 20°C. Six successive 1 second frames were collected through the SEC elution peak of the sample. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 50.1,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 53.0,
"porod_mw_error": null,
"pddf_i0": 0.009356,
"pddf_i0_error": null,
"guinier_i0": 0.009368,
"guinier_i0_error": 6.4e-05,
"pddf_rg": 3.34,
"pddf_rg_error": null,
"guinier_rg": 3.307,
"guinier_rg_error": 0.037,
"pddf_dmax": 10.2,
"pddf_dmax_error": null,
"porod_volume": 84.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 4,
"guinier_point_last": 43,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDGK2_datloglog_img.png",
"symmetry": null,
"last_modified": "2021-04-14T10:05:01.159563+02:00",
"bragg_peak": []
}
