The tandem SH2 domains of Tyrosine-protein kinase SYK with a bound CD3G diphospho-ITAM peptide

{
  "code": "SASDUV7",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "The mechanism of allosteric activation of SYK kinase derived from multiple phospho-ITAM-bound structures",
    "publication": {
      "title": "The mechanism of allosteric activation of SYK kinase derived from multiple phospho-ITAM-bound structures",
      "author_list": "Bradshaw W, Harris G, Gileadi O, Katis V",
      "journal": "Structure",
      "doi": "10.1016/j.str.2024.09.024",
      "pmid": null,
      "published_date": "2024 Oct"
    },
    "status": "released",
    "submitted_date": "2024-04-29",
    "released_date": "2024-10-07"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDUV7.dat",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDUV7.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUV7_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUV7_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDUV7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUV7_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUV7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "Diamond Light Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "B21",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Tyrosine-protein kinase SYK",
          "short_name": "SYK",
          "sequence": "SMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVN",
          "organism": "Homo sapiens",
          "uniprot_code": "P43405",
          "uniprot_range_first": 6,
          "uniprot_range_last": 269,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK\nAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF\nEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ\nIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL\nVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK\nPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP\nKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE\nANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM\nGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA\nPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE\nMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN",
          "mw": 29.862,
          "total_mw": 29.862,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        },
        {
          "long_name": "T-cell surface glycoprotein CD3 gamma chain",
          "short_name": "CD3G",
          "sequence": "DQLYQPLKDREDDQYSHLQG",
          "organism": "Homo sapiens",
          "uniprot_code": "P09693",
          "uniprot_range_first": 157,
          "uniprot_range_last": 176,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK\nMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF\nAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR\nRN",
          "mw": 2.609,
          "total_mw": 2.609,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "10 mM HEPES, 150 mM NaCl, 1 mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "The tandem SH2 domains of Tyrosine-protein kinase SYK with a bound CD3G diphospho-ITAM peptide",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Oxford, UK",
            "full_name": "University of Oxford",
            "webpage": "http://www.ox.ac.uk/"
          }
        ],
        "contributor_name": "William",
        "contributor_surname": "Bradshaw",
        "orcid": "https://orcid.org/0000-0002-7985-9752"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2023-11-13",
    "storage_temperature": 15.0,
    "cell_temperature": 15.0,
    "exposure_time": 3.0,
    "number_of_frames": 600,
    "wavelength": 0.09408,
    "sample_detector_distance": 3.712,
    "concentration_min": null,
    "concentration_max": 10.0,
    "sample_volume": 45.0,
    "flow_rate": 0.08,
    "s_min": 0.102,
    "s_max": 2.543,
    "total_exposure_time": null,
    "seccolumn": 4
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ScÅtter",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of the tandem SH2 domains of Tyrosine-protein kinase SYK with a bound CD3G diphospho-ITAM peptide in 10 mM HEPES, 150 mM NaCl, 1 mM TCEP, pH 7.5 were collected on the B21 beam line at the Diamond Light Source (Didcot, UK) using a Eiger 4M detector at a sample-detector distance of 3.7 m and at a wavelength of λ = 0.09408 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 45.00 μl sample at 10 mg/ml was injected at a 0.08 ml/min flow rate onto a GE Superdex 75 Increase 5/150 column at 15°C. 600 successive 3 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 33.434,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 33.434,
  "porod_mw_error": null,
  "pddf_i0": 0.1696971,
  "pddf_i0_error": null,
  "guinier_i0": 0.0218267,
  "guinier_i0_error": null,
  "pddf_rg": 2.18,
  "pddf_rg_error": null,
  "guinier_rg": 2.144,
  "guinier_rg_error": 0.012,
  "pddf_dmax": 7.05,
  "pddf_dmax_error": null,
  "porod_volume": 55.5,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 1,
  "guinier_point_last": 343,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDUV7_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2024-10-23T10:59:49.687069+02:00",
  "bragg_peak": []
}

{
  "code": "SASDUV7",
  "status": "success",
  "started_at": "2026-08-11T15:41:00.153601+00:00",
  "finished_at": "2026-08-11T15:41:08.536571+00:00",
  "source_last_modified": "2024-10-23T10:59:49.687069+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDUV7/",
      "path": "/data/saxsdb/sasbdb/entries/v7/sasduv7/source/summary.json",
      "size": 7834,
      "sha256": "aea50fc9c3f1a73512438f6f11bae1923111d329e28748edc56bdeb00bd40d5e"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDUV7.dat",
      "path": "/data/saxsdb/sasbdb/entries/v7/sasduv7/source/SASDUV7.dat",
      "size": 90657,
      "sha256": "07073c246aa749da0ab3840de68091c22518456b7a410e4784cb97eb5005aa93",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDUV7.dat",
      "path": "/data/saxsdb/sasbdb/entries/v7/sasduv7/source/SASDUV7.out",
      "size": 3916,
      "sha256": "f4cef55af09b2e85a447a29ada5e10343926599688cc7f091a56bbd1de8b3867",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUV7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/v7/sasduv7/source/SASDUV7.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDUV7.zip",
      "path": "/data/saxsdb/sasbdb/entries/v7/sasduv7/source/SASDUV7.zip",
      "size": 30930,
      "sha256": "90ce2e494835341d5a4cc3517fd5bedff172960a6d37eb41f773bad23d0f0b84",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}