The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDUW2",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/nm",
"project": {
"title": "Sequential conformational transition of ArnB, an archaeal ortholog with Sec23/Sec24 core motif",
"publication": {
"title": "Sequential conformational transition of ArnB, an archaeal ortholog with Sec23/Sec24 core motif",
"author_list": "Essen L, Korf L, Steinchen W, Watad M, Bezold F, Vogt M, Selbach L, Penner A, Tourte M, Hepp S, Albers S",
"journal": null,
"doi": "10.21203/rs.3.rs-3955852/v1",
"pmid": null,
"published_date": "2024 Mar 11"
},
"status": "released",
"submitted_date": "2024-02-09",
"released_date": "2025-11-19"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDUW2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDUW2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUW2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUW2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDUW2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUW2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUW2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Conserved protein",
"short_name": "ArnA",
"sequence": "MTWKCNLCGYENDDDALFCIKCGAQKSSEAQQLPQQQPSEPQAQGVVTQQQVVTNPPVQA\r\nQVATPQQPAQQPVLPQPEPAQPQPVSSTPAPQQASQPTNRYYIYFIQTPNENLVNKKVLL\r\nNFDLFPSVSMGRSPENIVIVPDSEVSRKHAVIYLDNSELYIEDLNSTNGTYVYDGKQFTP\r\nIKGKQKIEPNSIIKLGNQTIVRILKEWSHPQFEK",
"organism": "Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)",
"uniprot_code": "Q4J9H4",
"uniprot_range_first": 1,
"uniprot_range_last": 206,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MTWKCNLCGYENDDDALFCIKCGAQKSSEAQQLPQQQPSEPQAQGVVTQQQVVTNPPVQA\nQVATPQQPAQQPVLPQPEPAQPQPVSSTPAPQQASQPTNRYYIYFIQTPNENLVNKKVLL\nNFDLFPSVSMGRSPENIVIVPDSEVSRKHAVIYLDNSELYIEDLNSTNGTYVYDGKQFTP\nIKGKQKIEPNSIIKLGNQTIVRILKE",
"mw": 23.992,
"total_mw": 23.992,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "ArnA is a component of the archaella regulatory network. The protein construct used for SAXS contains an additional non-native WSHPQFEK C-terminal extension."
},
{
"long_name": "Conserved protein",
"short_name": "ArnB",
"sequence": "MATISVKAELSHKYSFTSPLKGVFRLIIVPEKVSTARGFHYIILLDTSGSMYGVKIETAKQGAMELLSRIPEGNKISFLTFSNNVNILSEYADAPSLVQQIKQIRSGGQTVLYRALERAIEIAKKHDLPGYIILLTDGQPTDVPETDAYEKLNYPEAYKVIAFGIGDDYNERLLKVITDKTAGILYHVEDAKEIAEMLPQSAVTEIGAKNVSIDIVSETQVKLLNYPGPPVKLGAVESVVRVYGEIIIPPNFTGRLATVKISYEDPLSSRINRLEVNFDITRANDVKRFLDGINNDLVNEYRYYELMSKLANQLNSNNLSEATRTVEQMQMIAQQTRRMELIETTRRISESIETTRRIGTVEQTRKISKEITSEVTKKLRSHHHHHH",
"organism": "Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)",
"uniprot_code": "Q4J9H3",
"uniprot_range_first": 2,
"uniprot_range_last": 380,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MTISVKAELSHKYSFTSPLKGVFRLIIVPEKVSTARGFHYIILLDTSGSMYGVKIETAKQ\nGAMELLSRIPEGNKISFLTFSNNVNILSEYADAPSLVQQIKQIRSGGQTVLYRALERAIE\nIAKKHDLPGYIILLTDGQPTDVPETDAYEKLNYPEAYKVIAFGIGDDYNERLLKVITDKT\nAGILYHVEDAKEIAEMLPQSAVTEIGAKNVSIDIVSETQVKLLNYPGPPVKLGAVESVVR\nVYGEIIIPPNFTGRLATVKISYEDPLSSRINRLEVNFDITRANDVKRFLDGINNDLVNEY\nRYYELMSKLANQLNSNNLSEATRTVEQMQMIAQQTRRMELIETTRRISESIETTRRIGTV\nEQTRKISKEITSEVTKKLRS",
"mw": 43.651,
"total_mw": 43.651,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "ArnB component of archaealla regulatory network. The protein construct used for SAXS contains an additional C-terminal polyhistidine tag (HHHHHH)."
}
],
"buffer": {
"name": "50 mM Tris, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "ArnA-ArnB complex, unphosphorylated",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Marburg, Germany",
"full_name": "Philipps-Universität Marburg",
"webpage": ""
}
],
"contributor_name": "Lars-Oliver",
"contributor_surname": "Essen",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-02-15",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": null,
"number_of_frames": null,
"wavelength": 0.1,
"sample_detector_distance": 2.43,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.065,
"s_max": 4.928,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUW2_fit1_model1_img.png",
"software": "DAMMIN",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "DAMAVER 5.0 (r9988)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDUW2_fit1_model1.pdb",
"model_mw": 52.389,
"bead_radius": null,
"log": null,
"symmetry": "P1",
"comment": null,
"user": 1032
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUW2_fit1_fixed_fit_img.png",
"software": "DAMMIN",
"chi_square_value": 1.013,
"p_value": 0.3633,
"fit_residual_plot": "SASDUW2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUW2_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/merge_001ArnAB2.log",
"software_version": "5.3",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of the ArnA-ArnB complex in 50 mM Tris, 150 mM NaCl, pH 8 were collected on the BM29 beam line at the ESRF (Grenoble, France) at 20°C using a Pilatus 1M detector at a sample-detector distance of 2.4 m and at a wavelength of λ = 0.1 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentration were merged with the highest concentration high angle data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 64.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 50.0,
"porod_mw_error": null,
"pddf_i0": 53.88,
"pddf_i0_error": 0.994,
"guinier_i0": 55.1606,
"guinier_i0_error": null,
"pddf_rg": 4.196,
"pddf_rg_error": 0.183,
"guinier_rg": 4.153,
"guinier_rg_error": 0.112,
"pddf_dmax": 19.2,
"pddf_dmax_error": null,
"porod_volume": 80.7,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 7,
"guinier_point_last": 40,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDUW2_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-11-19T15:49:10.026533+01:00",
"bragg_peak": []
}
