The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDUW5",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Structural Basis for Membrane Targeting and Secretion of Legionella SidE Ubiquitin Ligases",
"publication": null,
"status": "released",
"submitted_date": "2024-03-29",
"released_date": "2025-11-19"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDUW5.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDUW5.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUW5_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUW5_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDUW5_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUW5_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUW5.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Ubiquitinating/deubiquitinating enzyme SdeA",
"short_name": null,
"sequence": "GSDFSDVEKLEQQIQVIDTKLADAYLLEVTKQISALDNTKPKNQTELKTKIAAFLDRTTDIEMLRNERIKKHGSSKDPLDLSDLDKLSGSLQRINQSLVSDLITTIRVSINQMEAKTFHEQEKEIQQNFELLAKLEKTLDKSKTSEKLREDIPKLNDLLVAKQKAYPQMVQMQLKSEVFVTQLREVCQANHDDLDKTRNARLRELDRLDREAGITRMVGNLIWGLTNKVGLTTDERLDIRTKQQSLARFKNELFNDKIDTDQLISNLARKRPSELQEGLGISTDNAMELHLLLTELAGKTTSPDELEERMKAIDDISTKIGREPEHLKFVMVEEDESNKKTIGF",
"organism": "Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)",
"uniprot_code": "Q5ZTK4",
"uniprot_range_first": 1158,
"uniprot_range_last": 1499,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPKYVEGVELTQEGMHAIFARMGYGDITSGSIYNGVPTIDTGALNRQGFMPVLTGVGPHR\nDSGHWIMLIKGPGNQYYLFDPLGKTSGEGYQNILAAQLPMGSTLSVIPNGSGLNMGLCGY\nWVASAGLRAHQALNQHNPPTLLNVGQTITNEMRNELDHDGYRKITGWLRAVADEFPEGDP\nQLDGKALRENTEKDLKIEIPTLVLPGKDTSPKEMSVKPTAPQDKSVPVWNGFSLYTDDTV\nKAAAQYAYDNYLGKPYTGSVESAPANFGGRMVYRQHHGLSHTLRTMAYAELIVEEARKAK\nLRGETLGKFKDGRTIADVTPQELKKIMIAQAFFVAGRDDEASDAKNYQKYHEQSRDAFLK\nYVKDNESTLIPDVFKDQEDVNFYARVIEDKSHDWESTPAHVLINQGHMVDLVRVKQPPES\nFLQRYFSSMQRWIGSQATEAVFGIQRQFFHATYEVVAGFDSDNKEPHLVVSGLGRYVIGE\nDGQPIREAPKKGQKEGDLKVFPQTYKLKENERLMRVDEFLKLPEIQNTFPGSGKHLQGGM\nPGMNEMDYWNRLNSLNRARCENDVDFCLKQLQTAHDKAKIEPIKQAFQSSKGKERRQPNV\nDEIAAARIIQQILANPDCIHDDHVLINGQKLEQQFFRDLLAKCEMAVVGSLLNDTDIGNI\nDTLMRHEKDTEFHSTNPEAVPVKIGEYWINDQRINNSSGNITQKKHDLIFLMQNDAWYFS\nRVNAIAQNRDKGSTFKEVLITTLMTPLTSKALVDTSQAKPPTRLFRGLNLSEEFTKGLID\nQANAMIANTTERLFTDHSPEAFKQIKLNDLSKMSGRTNASTTTEIKLVKETWDSNVIFEM\nLDPDGLLHSKQVGRHGEGTESEFSVYLPEDVALVPVKVTLDGKTQKGENRYVFTFVAVKS\nPDFTPRHESGYAVEPFLRMQAAKLAEVKSSIEKAQRAPDLETIFNLQNEVEAVQYSHLST\nGYKNFLKNTVGPVLENSLSGLMESDTDTLSKALAAFPSDTQWSAFNFEEARQAKRQMDAI\nKQMVGNKVVLDALTQCQDALEKQNIAGALDALKKIPSEKEMGTIRRELREQIQSARQELE\nSLQRAVVTPVVTDEKKVRERYDALIENTSKKITELETGKLPNLDAVKKGISNLSNLKQEV\nTVLRNEKIRMHVGTDKVDFSDVEKLEQQIQVIDTKLADAYLLEVTKQISALDNTKPKNQT\nELKTKIAAFLDRTTDIEMLRNERIKKHGSSKDPLDLSDLDKLSGSLQRINQSLVSDLITT\nIRVSINQMEAKTFHEQEKEIQQNFELLAKLEKTLDKSKTSEKLREDIPKLNDLLVAKQKA\nYPQMVQMQLKSEVFVTQLREVCQANHDDLDKTRNARLRELDRLDREAGITRMVGNLIWGL\nTNKVGLTTDERLDIRTKQQSLARFKNELFNDKIDTDQLISNLARKRPSELQEGLGISTDN\nAMELHLLLTELAGKTTSPDELEERMKAIDDISTKIGREPEHLKFVMVEEDESNKKTIGF",
"mw": 39.388,
"total_mw": 39.388,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Protein construct used for SAXS contains an additional two non-native amino acids at N-terminus (GS)."
}
],
"buffer": {
"name": "25 mM Tris-HCl, 200 mM NaCl, 5 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "C-terminal domain of Ubiquitinating/deubiquitinating enzyme SdeA (SdeA_CTD)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "EMBL-Hamburg",
"address": "Notkestraße 85, Geb. 25A, 22607 Hamburg, Deutschland, Germany",
"full_name": "European Molecular Biology Laboratory (EMBL) - Hamburg outstation",
"webpage": "http://www.embl-hamburg.de/index.php"
}
],
"contributor_name": "Ahmed",
"contributor_surname": "Mohammed",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2020-12-04",
"storage_temperature": 25.0,
"cell_temperature": 25.0,
"exposure_time": 1.0,
"number_of_frames": 36,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 16.5,
"sample_volume": 100.0,
"flow_rate": 0.7,
"s_min": 0.148,
"s_max": 4.102,
"total_exposure_time": null,
"seccolumn": 3
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUW5_fit1_model1_img.png",
"software": "MONSA",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "1.45 (r12592)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDUW5_fit1_model1.pdb",
"model_mw": null,
"bead_radius": 4.25,
"log": null,
"symmetry": null,
"comment": null,
"user": 700
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUW5_fit1_fixed_fit_img.png",
"software": "MONSA",
"chi_square_value": 1.246,
"p_value": 0.0586,
"fit_residual_plot": "SASDUW5_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUW5_fit1.fit",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUW5_fit2_model1_img.png",
"software": "SREFLEX",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDUW5_fit2_model1.pdb",
"model_mw": 37.98,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 700
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUW5_fit2_fixed_fit_img.png",
"software": "SREFLEX",
"chi_square_value": 3.984,
"p_value": 0.0,
"fit_residual_plot": "SASDUW5_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUW5_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of SdeA_CTD in 25 mM Tris-HCl, 200 mM NaCl, 5 mM DTT, pH 7.5 were collected on the EMBL P12 beam line at PETRA III (DESY; Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 100.00 μl sample at 16.5 mg/ml was injected at a 0.70 ml/min flow rate onto a GE Superdex 75 Increase 10/300 column at 25°C. 36 successive 1 second frames were collected through the main SEC elution peak. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 40.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 38.8,
"porod_mw_error": null,
"pddf_i0": 21430.0,
"pddf_i0_error": null,
"guinier_i0": 20963.4,
"guinier_i0_error": null,
"pddf_rg": 4.151,
"pddf_rg_error": null,
"guinier_rg": 3.865,
"guinier_rg_error": 0.011,
"pddf_dmax": 15.7,
"pddf_dmax_error": null,
"porod_volume": 62.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 2,
"guinier_point_last": 68,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDUW5_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-11-19T15:45:31.938512+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDUW5",
"status": "success",
"started_at": "2026-08-11T14:58:05.009307+00:00",
"finished_at": "2026-08-11T14:58:13.563216+00:00",
"source_last_modified": "2025-11-19T15:45:31.938512+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDUW5/",
"path": "/data/saxsdb/sasbdb/entries/w5/sasduw5/source/summary.json",
"size": 9888,
"sha256": "ed7792d39d9a8d5cc729a9e15f0953e64ef0f69bb572628ed092c80cdf54e937"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDUW5.dat",
"path": "/data/saxsdb/sasbdb/entries/w5/sasduw5/source/SASDUW5.dat",
"size": 65693,
"sha256": "58a2743d06eecf89fa51a64ee2701588613ad8acd79962225f96f2bda331cd43",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDUW5.out",
"path": "/data/saxsdb/sasbdb/entries/w5/sasduw5/source/SASDUW5.out",
"size": 79534,
"sha256": "a06466456e5cc24bcd211c8d985a3a4cbc527121df70cf34d8f63fcbd08b2fed",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUW5.sascif",
"path": "/data/saxsdb/sasbdb/entries/w5/sasduw5/source/SASDUW5.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDUW5.zip",
"path": "/data/saxsdb/sasbdb/entries/w5/sasduw5/source/SASDUW5.zip",
"size": 126705,
"sha256": "7d92f970a45803969f2472af9a052586eded617b64fde6e95db7e253c61e8976",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
