The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDUX6",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structural basis for IL-33 recognition and its antagonism by the helminth effector protein HpARI2.",
"publication": {
"title": "Structural basis for IL-33 recognition and its antagonism by the helminth effector protein HpARI2.",
"author_list": "Jamwal A, Colomb F, McSorley HJ, Higgins MK",
"journal": "Nat Commun",
"doi": "10.1038/s41467-024-49550-0",
"pmid": "38890291",
"published_date": "2024 Jun 19"
},
"status": "released",
"submitted_date": "2024-04-10",
"released_date": "2024-04-25"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDUX6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDUX6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUX6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUX6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDUX6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUX6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUX6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Alarmin release inhibitor (Δ1-125; N175Q, N190Q)",
"short_name": "HpARI2_CC23",
"sequence": "GCKGILEMLFDMPKEERPSPMYDSVTYDPTPNTPTTVGKDGIWNGVDYRQGSTVKPYCDTGPVIQGSSKAVCVSGKWVPTLGVCPKMCSIGSLKENGKFVDVTATTKGDELNPPPREQTLIPIVRKVDKDKVQHGVKVVALCKAEDSTTAAEGVQEFECDNGKWKPEPVPCP",
"organism": "Heligmosomoides polygyrus",
"uniprot_code": "A0A3P7XL18",
"uniprot_range_first": 126,
"uniprot_range_last": 297,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MDIIGQVYCFTGAPHTITCLLREQFINWYIKYKRSENYPAFRELVVMYRLFLALGFLTFI\nNAAGQRCRFTDVERDKGYTGMLLKGRLRKTAGNGRTVELICGRGNHNYTCESGVLKESSP\nRQARCGCKGILEMLFDMPKEERPSPMYDSVTYDPTPNTPTTVGKDGIWNGVDYRNGSTVK\nPYCDTGPVINGSSKAVCVSGKWVPTLGVCPKMCSIGSLKENGKFVDVTATTKGDELNPPP\nREQTLIPIVRKVDKDKVQHGVKVVALCKAEDSTTAAEGVQEFECDNGKWKPEPVPCP",
"mw": 18.615,
"total_mw": 18.615,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "137 mM NaCl, 2.7 mM KCl, 10 mM phosphate buffer, 5% glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.2,
"deuteration": null
},
"purity_method": null,
"name": "Alarmin release inhibitor (HpARI2) domains CCP2 and CCP3",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Department of Biochemistry, University of Oxford",
"webpage": null
}
],
"contributor_name": "Matt",
"contributor_surname": "Higgins",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-02-09",
"storage_temperature": 15.0,
"cell_temperature": 15.0,
"exposure_time": 3.0,
"number_of_frames": 600,
"wavelength": 0.09464,
"sample_detector_distance": 3.7025,
"concentration_min": null,
"concentration_max": 7.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.045,
"s_max": 3.4,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUX6_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDUX6_fit1_model1.pdb",
"model_mw": null,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1054
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUX6_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 0.982,
"p_value": 0.0024,
"fit_residual_plot": "SASDUX6_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUX6_fit1.fir",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUX6_fit2_model1_img.png",
"software": "Chimera",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDUX6_fit2_model1.pdb",
"model_mw": 17.36,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1054
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUX6_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 2.402,
"p_value": 0.0,
"fit_residual_plot": "SASDUX6_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUX6_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of the alarmin release inhibitor domains CCP2 and CCP3 in 137 mM NaCl, 2.7 mM KCl, 10 mM phosphate buffer, 5% glycerol, pH 7.2 were collected on the B21 beam line at the Diamond Light Source (Didcot, UK) using a Eiger 4M detector at a sample-detector distance of 3.7 m and at a wavelength of λ = 0.09464 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 7.00 mg/ml was measured at 15°C. 600 successive 3 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 19.04,
"experimental_mw_error": null,
"guinier_i0_mw": 16.52,
"guinier_i0_mw_error": null,
"porod_mw": 17.0,
"porod_mw_error": null,
"pddf_i0": 0.01695,
"pddf_i0_error": null,
"guinier_i0": 0.0168623,
"guinier_i0_error": null,
"pddf_rg": 2.34,
"pddf_rg_error": null,
"guinier_rg": 2.266,
"guinier_rg_error": 0.077,
"pddf_dmax": 8.19,
"pddf_dmax_error": null,
"porod_volume": 27.8,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 58,
"guinier_point_last": 404,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDUX6_datloglog_img.png",
"symmetry": null,
"last_modified": "2024-06-23T14:27:49.757808+02:00",
"bragg_peak": []
}
