The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDUY7",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/nm",
"project": {
"title": "Structural and functional repurposing of picornaviral H-box 2A proteins",
"publication": null,
"status": "released",
"submitted_date": "2024-04-30",
"released_date": "2026-04-30"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDUY7.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDUY7.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUY7_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUY7_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDUY7_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUY7_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUY7.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Genome polyprotein",
"short_name": "AiV-2A",
"sequence": "GPGGAASATPDVDPDDRVYIVRAQRPTYVHWAIRKVAPDGSAKQISLSRSGIQALVALEPPEGEPYLEILPSHWTLAELQLGNKWEYSATNNCTHFVSSITGESLPNTGFSLALGIGALTAIAASAAVAVKALPGIRRQ",
"organism": "Aichi virus (strain Human/A846/88/1989)",
"uniprot_code": "O91464",
"uniprot_range_first": 1017,
"uniprot_range_last": 1152,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAATRVSRSVLAAVAHSAAHRTYHTVLDCYDRLYLNTNPHLSYPLPKNSSFPCPFCQYDE\nQNEVLSPESLRGEGAEPCWKCSQDKPRRKYNTTPPEDWLYDSDVQSWFYPETYYSDLQQK\nFFDKLALLSLPGAYQAKTPEERALAGALTQLLNFPSTPPLTLPTTNLQRQGNSVTNIYGN\nGNNVTTDVGANGWAPTVSTGLGDGPVSASADSLPGRSGGASSEKTHTVSGSSNKVGSRFS\nKWWEPAAARASESATDSAIEGIDAAGKAASKAITRKLDRPAAPSSTANPQPSLIALNPSA\nTQSGNASILTGSTAPSLLAYPTATPVPLPNPDEPSQPGPSGDRTWLLDTVTWSQEFTRGW\nNIAGSNGMQWTGLESLIFPVSTDTNWTSTSSPTAYPLPFSFVRAYPDSSWAAMYNTHSMW\nNCGWRVQVTVNGSQFHAGALILYMVPEATTHAIQTARDNAGFVFPYVILNLYESNTATIE\nVPYISPTPNTSSGLHAPWTFYLQVLSPLNPPPSLPTSLSCSIYVTPVDSSFHGLRYLAPQ\nHWKTRAVPGAGTFGSAVAGQELPLCGVRAYYPPNAYIPAQVRDWLEFAHRPGLMATVPWT\nMADEPAERLGIFPVSPSAIAGTGAPISYVISLFSQWRGELAAHLLFTGSAQHYGRLVVCY\nTPAAPQPPSTMQEAMRGTYTVWDVNAASTLEFTIPFISNSYWKTVDVNNPDALLSTTGYV\nSIWVQNPLVGPHTAPASALVQAFISAGESFNVRLMQNPALTSQTLTEDLDAPQDTGNIEN\nGAADNSPQPRTTFDYTGNPLPPDTKLENFFSFYRLLPMGGSGAPSLSFPADEGTIIPLNP\nINWLKGADVSGIAAMLSCFTYIAADLRITLRFSNPNDNPATMLVAFAPPGATIPLKPTRQ\nMLSNFYMAEVPVSAATSTMVSFSIPYTSPLSAIPTSYFGWEDWSGTNFGQLSSGSWGNLM\nLIPSLSVDSAIPFDFQLSCWVAFGNFKAWVPRPPPPLPPLPTPAANAERTVAVIKQGAAS\nATPDVDPDDRVYIVRAQRPTYVHWAIRKVAPDGSAKQISLSRSGIQALVALEPPEGEPYL\nEILPSHWTLAELQLGNKWEYSATNNCTHFVSSITGESLPNTGFSLALGIGALTAIAASAA\nVAVKALPGIRRQGLLTLSADTETNQTLNKITESVNQAAQVVSQFDLSGPANSVSLAASDI\nREAAHKVASSLNGFTDVIADIKDSLFTRVSDAVESGVATFLTWLVKLFGYLLVLFGSPTP\nMSISGLLVIICADLAPHAREFFTASGNVLSSLYYWIASKLGLSVTPQECERATLEPQGLK\nDFNDGALAMRNVEWIGETAWKWAHRLLDWIRGKAKTDPQAKLADVHDEIMLHYSDSILAL\nGSEKLPIDHITKSISRCRELVSIAQEAKSGPHSSFLNQAIKNYTLAISQHRKCQTGPRPE\nPVVVYLYGPPGTGKSLLASLLAQTLSQRLAGTPDDVYSPSSASCEYFDGYTGQTVHFIDD\nIGQDPEGRDWANFPNLVSSAPFIVPMASLEEKGTHYTSKVIVVTSNFHEPNERAARSMGA\nLRRRVHLRINVTSNGVPFDPTNALNPIPGTQSKYFTAQTPLTLFQSNTVRLDRDSIWTPT\nFTNMDELVDAIVTRLDRSTGVSNSLASLIRRQGNRVIDAEPREIPLEYADDLLEAMAHHR\nPVPCSLGLSQAIANNTPIQQISETFWKYRKPIFTCTTFLAVLGFLCSVIPLARSLWKSKQ\nDTPQEPQAAYSAISHQKPKPKSQKPVPTRHIQRQGISPAVPGISNNVVHVESGNGLNKNV\nMSGFYIFSRFLLVPTHLREPHHTTLTVGADTYDWATLQTQEFGEITIVHTPTSRQYKDMR\nRFIGAHPHPTGLLVSQFKAAPLYVRISDNRILDLDFPGVVVCKQAYGYRAATFEGLCGSP\nLVTDDPSGVKILGLHVAGVAGTSGFSAPIHPILGQITQFATTQQSLIVPTAEVRPGVNVN\nRMSRLHPSPAYGAFPVKKQPAPLKRNDKRLQEGVDLDTQLFLKHGKGDVTEPWPGLEAAA\nDLYFSTFPTSLPVLTQEQAIHGTPNMEGLDMGQAAGYPWNTLGRSRRSLFDEVEPGVFVP\nKPELQAEINQTLEDPDYVYSTFLKDELRPTAKVEQGLTRIVEAAPIHAIVAGRMLLGGLI\nDYMQGRPGEHGSAVGCNPDVHWTSFFYAFSEFSQVYDLDYKCFDATLPSAVFTLVADHLT\nRITGDPRVGRYIHSIRHSHHIYGNRMYDMIGGNPSGCVATSILNTIINNICVLSALIQHP\nDFSPSRFHILAYGDDVIYATEPPIHPSFLREFYQKHTPLVVTPANKGQDFPPTSTIYEVT\nFLKRWFVPDDVRPIYIHPVMDPDTYEQSVMWLRDGDFQDVVTSLCHLAFHSGPKTYAAWC\nMKVREQCLKSGFAPNFLPYSYLQLRWLNLLAA",
"mw": 14.63,
"total_mw": 14.63,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Aichivirus 2A protein from the Genome polyprotein. Recombinant protein expressed in E.coli."
}
],
"buffer": {
"name": "20 mM HEPES,150 mM NaCl, 2 mM TCEP, 1% v/v glycerol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Aichivirus A 2A protein at neutral pH",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Linköping University ",
"webpage": null
}
],
"contributor_name": "Marion",
"contributor_surname": "Pichon",
"orcid": "https://orcid.org/0000-0002-8511-4298"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2022-03-11",
"storage_temperature": 10.0,
"cell_temperature": 20.0,
"exposure_time": 0.24,
"number_of_frames": 2880,
"wavelength": 0.1549,
"sample_detector_distance": 4.0,
"concentration_min": null,
"concentration_max": 10.0,
"sample_volume": 40.0,
"flow_rate": 0.35,
"s_min": 0.013,
"s_max": 4.445,
"total_exposure_time": null,
"seccolumn": 4
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUY7_fit1_model1_img.png",
"software": "PyMOL",
"pdb_link": [
{
"pdb_code": "7zv6",
"ext_code": "7ZV6",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDUY7_fit1_model1.pdb",
"model_mw": 37.0,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/7ZV6.log",
"symmetry": null,
"comment": "Chains A+B+C used as model for rigid body analysis",
"user": 990
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUY7_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 153.4922,
"p_value": 0.0,
"fit_residual_plot": "SASDUY7_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUY7_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/7ZV6_chromixs66cut.log",
"software_version": "crysol, ATSAS 3.2.1 (r14885)",
"description": "Rigid body fit of the chains A + B + C"
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUY7_fit2_model1_img.png",
"software": "PyMOL",
"pdb_link": [
{
"pdb_code": "7zv6",
"ext_code": "7ZV6",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDUY7_fit2_model1.pdb",
"model_mw": 12.82,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Chains B used for model fitting.",
"user": 990
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUY7_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 10.96,
"p_value": 0.0,
"fit_residual_plot": "SASDUY7_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUY7_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/7ZV6_B_chromixs66cut.log",
"software_version": "crysol, ATSAS 3.2.1 (r14885)",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDUY7_fit3_model1_img.png",
"software": "SREFLEX",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "sreflex, ATSAS 3.2.1 (r14885)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDUY7_fit3_model1.pdb",
"model_mw": 12.82,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": "Model obtained from sReflex with 7ZV6 Chain B as template",
"user": 990
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDUY7_fit3_fixed_fit_img.png",
"software": "SREFLEX",
"chi_square_value": 5.09,
"p_value": 0.0,
"fit_residual_plot": "SASDUY7_fit3_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDUY7_fit3.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "Data were processed using the ATSAS suite. The high resolution structure of AiV-2A (chain A, B, C and A+B+C) theoretical scattering curve was fitted to the experimental data using rigid body and normal mode analysis (SREFLEX). CAUTION: The monomer component of the models (12.8 kDa) does not include all of the amino acids of the protein construct used for SAXS (14.6 kDa).",
"experiment_description": "Synchrotron SAXS data from solutions of Aichivirus A 2A protein at neutral pH in 20 mM HEPES,150 mM NaCl, 2 mM TCEP, 1% v/v glycerol, pH 7.4 were collected on the EMBL P12 beam line at PETRA III (DESY; Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 4 m and at a wavelength of λ = 0.1549 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 40.00 μl sample at 10 mg/ml was injected at a 0.35 ml/min flow rate onto a GE Superdex 75 Increase 5/150 column at 20°C. 2880 successive 0.240 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 12.025,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 10.98,
"porod_mw_error": null,
"pddf_i0": 0.03016,
"pddf_i0_error": 3.526e-05,
"guinier_i0": 0.0299389,
"guinier_i0_error": null,
"pddf_rg": 1.863,
"pddf_rg_error": 0.005,
"guinier_rg": 1.785,
"guinier_rg_error": 0.006,
"pddf_dmax": 7.4,
"pddf_dmax_error": null,
"porod_volume": 17.57,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 52,
"guinier_point_last": 426,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDUY7_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-04-30T16:35:52.435483+02:00",
"bragg_peak": []
}
