Calcium/calmodulin-dependent protein kinase type II alpha (CaMKIIα) W403L hub domain

{
  "code": "SASDUZ4",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Ligand‐induced <scp>CaMKIIα</scp>\n              hub Trp403 flip, hub domain stacking, and modulation of kinase activity",
    "publication": {
      "title": "Ligand‐induced <scp>CaMKIIα</scp>\n              hub Trp403 flip, hub domain stacking, and modulation of kinase activity",
      "author_list": "Narayanan D, Larsen A, Gauger S, Adafia R, Hammershøi R, Hamborg L, Bruus‐Jensen J, Griem‐Krey N, Gee C, Frølund B, Stratton M, Kuriyan J, Kastrup J, Langkilde A, Wellendorph P, Solbak S",
      "journal": "Protein Science",
      "doi": "10.1002/pro.5152",
      "pmid": null,
      "published_date": "2024 Sep 14"
    },
    "status": "released",
    "submitted_date": "2024-03-18",
    "released_date": "2024-09-18"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDUZ4.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDUZ4.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUZ4_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUZ4_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDUZ4_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUZ4_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUZ4.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus 6M",
        "resolution": null
      },
      "name": "PETRA III",
      "city": "DESY; Hamburg",
      "country": "Germany",
      "beamline_name": "EMBL P12",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Calcium/calmodulin-dependent protein kinase type II subunit alpha (W403L)",
          "short_name": "CaMKIIα W403L hub",
          "sequence": "GPHMVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLLSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSV",
          "organism": "Homo sapiens",
          "uniprot_code": "Q9UQM7",
          "uniprot_range_first": 345,
          "uniprot_range_last": 475,
          "oligomerization": "dodecamer",
          "molecular_type": "protein",
          "uniprot_sequence": "MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE\nARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL\nEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL\nSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV\nTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK\nGAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA\nISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH\nLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH",
          "mw": 15.404,
          "total_mw": 184.848,
          "number_molecules": 12,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "W403L mutant of the WT hub domain. The protein construct used for SAXS contains an additional four non-native amino acids at the N-terminus (GPHM)."
        }
      ],
      "buffer": {
        "name": "20 mM MES, 150 mM NaCl, 1 mM DTT",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 6.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Calcium/calmodulin-dependent protein kinase type II alpha (CaMKIIα) W403L hub domain",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Copenhagen, Denmark",
            "full_name": "University of Copenhagen",
            "webpage": "http://www.ku.dk/"
          }
        ],
        "contributor_name": "Annette",
        "contributor_surname": "Langkilde",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2023-03-17",
    "storage_temperature": 10.0,
    "cell_temperature": 20.0,
    "exposure_time": 0.095,
    "number_of_frames": 30,
    "wavelength": 0.124,
    "sample_detector_distance": 3.0,
    "concentration_min": null,
    "concentration_max": 6.4,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.02,
    "s_max": 4.47,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Single point mutant for comparison with the WT hub.",
  "experiment_description": "Synchrotron SAXS data from solutions of calcium/calmodulin-dependent protein kinase type II alpha (CaMKIIα) W403L hub domain in 20 mM MES, 150 mM NaCl, 1 mM DTT, pH 6 were collected on the EMBL P12 beam line at PETRA III (DESY; Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 6.40 mg/ml was measured at 20°C. 30 successive 0.095 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "1/cm",
  "experimental_mw": 186.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 223.0,
  "porod_mw_error": null,
  "pddf_i0": 0.2064,
  "pddf_i0_error": null,
  "guinier_i0": 0.20841,
  "guinier_i0_error": null,
  "pddf_rg": 4.603,
  "pddf_rg_error": null,
  "guinier_rg": 4.67,
  "guinier_rg_error": 0.017,
  "pddf_dmax": 16.5,
  "pddf_dmax_error": null,
  "porod_volume": 357.5,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 15,
  "guinier_point_last": 70,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDUZ4_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2024-09-18T12:55:13.625515+02:00",
  "bragg_peak": []
}

{
  "code": "SASDUZ4",
  "status": "success",
  "started_at": "2026-08-11T14:35:31.371864+00:00",
  "finished_at": "2026-08-11T14:35:38.893057+00:00",
  "source_last_modified": "2024-09-18T12:55:13.625515+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDUZ4/",
      "path": "/data/saxsdb/sasbdb/entries/z4/sasduz4/source/summary.json",
      "size": 6950,
      "sha256": "6e14b4e6c83e591526285efa7d1894d151827a516d3d769550db29fba828754e"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDUZ4.dat",
      "path": "/data/saxsdb/sasbdb/entries/z4/sasduz4/source/SASDUZ4.dat",
      "size": 71215,
      "sha256": "43b909c53194b284312bd9767cc8911ebaf4da032144308793f7961905aca56e",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDUZ4.out",
      "path": "/data/saxsdb/sasbdb/entries/z4/sasduz4/source/SASDUZ4.out",
      "size": 54530,
      "sha256": "b7575c5145ff5fc23cfb5c32386a90dac927435c6c51425583395fcce028aab8",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUZ4.sascif",
      "path": "/data/saxsdb/sasbdb/entries/z4/sasduz4/source/SASDUZ4.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDUZ4.zip",
      "path": "/data/saxsdb/sasbdb/entries/z4/sasduz4/source/SASDUZ4.zip",
      "size": 35670,
      "sha256": "e74fc65b58a1dc54cb5595d8c580caa9d7ffce6b8b8aa00c2db681c4cc46eb47",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}