BAM2 in 100 mM KCl (0.5 mg/mL)

{
  "code": "SASDUZ9",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Potassium cations expand the conformation ensemble of Arabidopsis thaliana β-amylase2 (BAM2).",
    "publication": {
      "title": "Potassium cations expand the conformation ensemble of Arabidopsis thaliana β-amylase2 (BAM2).",
      "author_list": "Sholes A, Asongakap R, Jaconski S, Monroe J, Berndsen CE",
      "journal": "MicroPubl Biol",
      "doi": "10.17912/micropub.biology.001257",
      "pmid": "39109193",
      "published_date": "2024"
    },
    "status": "released",
    "submitted_date": "2024-06-05",
    "released_date": "2024-07-12"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDUZ9.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDUZ9.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUZ9_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUZ9_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDUZ9_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDUZ9_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUZ9.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 X 2M",
        "resolution": 172.0
      },
      "name": "Advanced Light Source (ALS)",
      "city": "Berkeley, CA",
      "country": "USA",
      "beamline_name": "12.3.1 (SIBYLS)",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Beta-amylase 2, chloroplastic",
          "short_name": "BAM2",
          "sequence": "MGSSHHHHHHSQDPAESTEEDRVPIDDDDDSTDQLVDEEIVHFEERDFAGTACVPVYVMLPLGVIDMNSEVVEP\r\nEELLDQLRTLKSVNVDGVMVDCWWGIVESHTPQVYNWSGYKKLFQMIRELGLKIQVVMSF\r\nHECGGNVGDDVHIQIPEWVREIGQSNPDIYFTDSAGRRNTECLTWGIDKQRVLRGRTALE\r\nVYFDYMRSFRVEFDEFFEEKIIPEIEVGLGPCGELRYPSYPAQFGWKYPGIGEFQCYDKY\r\nLMNSLKEAAEVRGHSFWGRGPDNTETYNSTPHGTGFFRDGGDYDSYYGRFFLNWYSRVLI\r\nDHGDRVLAMANLAFEGTCIAAKLSGIHWWYKTASHAAELTAGFYNSSNRDGYGPIAAMFK\r\nKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDREG\r\nYNKILENAKPLTDPDGRHLSCFTYLRLNPTLMESQNFKEFERFLKRMHGEAVPDLGLAPG\r\nTQETNPE",
          "organism": "Arabidopsis thaliana",
          "uniprot_code": "O65258",
          "uniprot_range_first": 56,
          "uniprot_range_last": 542,
          "oligomerization": "tetramer",
          "molecular_type": "protein",
          "uniprot_sequence": "MAIRLNHSVIPVSVKLGAPTRVSARSSLPFSVGDWRGVSTFSGARPLVLAKVKLRAESTE\nEDRVPIDDDDDSTDQLVDEEIVHFEERDFAGTACVPVYVMLPLGVIDMNSEVVEPEELLD\nQLRTLKSVNVDGVMVDCWWGIVESHTPQVYNWSGYKKLFQMIRELGLKIQVVMSFHECGG\nNVGDDVHIQIPEWVREIGQSNPDIYFTDSAGRRNTECLTWGIDKQRVLRGRTALEVYFDY\nMRSFRVEFDEFFEEKIIPEIEVGLGPCGELRYPSYPAQFGWKYPGIGEFQCYDKYLMNSL\nKEAAEVRGHSFWGRGPDNTETYNSTPHGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDR\nVLAMANLAFEGTCIAAKLSGIHWWYKTASHAAELTAGFYNSSNRDGYGPIAAMFKKHDAA\nLNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDREGYNKIL\nENAKPLTDPDGRHLSCFTYLRLNPTLMESQNFKEFERFLKRMHGEAVPDLGLAPGTQETN\nPE",
          "mw": 57.141,
          "total_mw": 228.564,
          "number_molecules": 4,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM HEPES, 100 mM KCl",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "BAM2 in 100 mM KCl (0.5 mg/mL)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Harrisonburg, Virginia, USA",
            "full_name": "James Madison University",
            "webpage": "https://www.jmu.edu/"
          }
        ],
        "contributor_name": "Christopher",
        "contributor_surname": "Berndsen",
        "orcid": "https://orcid.org/0000-0002-4285-4341"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2019-09-17",
    "storage_temperature": 10.0,
    "cell_temperature": 10.0,
    "exposure_time": 0.3,
    "number_of_frames": 33,
    "wavelength": 0.127,
    "sample_detector_distance": 2.0,
    "concentration_min": null,
    "concentration_max": 0.5,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.081,
    "s_max": 3.999,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Recombinant, purified BAM2 was dialyzed into 50 mM HEPES, pH 7, and 100 mM KCl at 4  ̊C overnight. Samples at a concentration of 1 mg/mL in a plate were shipped overnight on dry ice to the SIBYLS beamline at the Advanced Light Source (Dyer et al., 2014). Prior to data collection, the plate was spun at 3700 rev min-1 for 10 min. Samples were held at 10℃ during collection. The exposure was 10 s, with frames collected every 0.3 s for a total of 30 frames per sample. The detector was 1.5 m from the sample, and the beam energy was 11 keV. Matching buffer exposures were collected before and after samples to ensure there was no difference in the scattering owing to contamination of the sample cell. This setup results in scattering vectors, q, ranging from 0.013 Å-1 to 0.5 Å-1, where the scattering vector is defined as q = 4πsinθ/λ and 2θ is the measured scattering angle. Radially averaged data were processed in SCATTER (ver 4.0d) and RAW (ver. 2.1.1) to remove the scattering of the sample solvent and identify peak scattering frames (Hopkins, 2024). RAW was used to calculate the dimensions of the molecule, the molecular weight, and the pair-distance distribution function (PDDF).",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 130.9,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 194.3,
  "porod_mw_error": null,
  "pddf_i0": 10.94,
  "pddf_i0_error": 0.007,
  "guinier_i0": 11.1232,
  "guinier_i0_error": null,
  "pddf_rg": 4.79,
  "pddf_rg_error": 0.029,
  "guinier_rg": 4.856,
  "guinier_rg_error": 0.06,
  "pddf_dmax": 15.0,
  "pddf_dmax_error": null,
  "porod_volume": 234.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 12,
  "guinier_point_last": 31,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDUZ9_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2024-08-07T20:59:33.375499+02:00",
  "bragg_peak": []
}

{
  "code": "SASDUZ9",
  "status": "success",
  "started_at": "2026-08-11T13:28:41.365187+00:00",
  "finished_at": "2026-08-11T13:28:49.309815+00:00",
  "source_last_modified": "2024-08-07T20:59:33.375499+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDUZ9/",
      "path": "/data/saxsdb/sasbdb/entries/z9/sasduz9/source/summary.json",
      "size": 7530,
      "sha256": "e17ab98747b2dd05f64235f7ea10d3149870d5e16feab145ca5b323652d3c630"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDUZ9.dat",
      "path": "/data/saxsdb/sasbdb/entries/z9/sasduz9/source/SASDUZ9.dat",
      "size": 38793,
      "sha256": "afad9d19bf17a2f46f416f489009211ed35a10c465ca9cb9ecfd1e70bf7c43fe",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDUZ9.out",
      "path": "/data/saxsdb/sasbdb/entries/z9/sasduz9/source/SASDUZ9.out",
      "size": 30738,
      "sha256": "ba1ede634839673e5299cd6331c905448f0a41fc3f5b79440248fca8d5f5341c",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDUZ9.sascif",
      "path": "/data/saxsdb/sasbdb/entries/z9/sasduz9/source/SASDUZ9.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDUZ9.zip",
      "path": "/data/saxsdb/sasbdb/entries/z9/sasduz9/source/SASDUZ9.zip",
      "size": 20686,
      "sha256": "4d6d7975543f9addd63ba3d8b5104d4584f620bbf83043f804ae261f386f7fd7",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}