The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDV43",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structural basis of microtubule-mediated signal transduction.",
"publication": {
"title": "Structural basis of microtubule-mediated signal transduction.",
"author_list": "Choi SR, Blum TB, Giono M, Roy B, Vakonakis I, Schmid D, Oelgarth N, Ranganathan A, Gossert AD, Shivashankar GV, Zippelius A, Steinmetz MO",
"journal": "Cell",
"doi": "10.1016/j.cell.2025.11.011",
"pmid": "41365297",
"published_date": "2025 Dec 8"
},
"status": "released",
"submitted_date": "2024-06-18",
"released_date": "2025-12-11"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDV43.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV43_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV43_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV43_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDV43.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Isoform 1 of Rho guanine nucleotide exchange factor 2",
"short_name": null,
"sequence": "MKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLYKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIKHHHHHH",
"organism": "Homo sapiens",
"uniprot_code": "Q92974",
"uniprot_range_first": 28,
"uniprot_range_last": 582,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSRIESLTRARIDRSRELASKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI\nTAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERP\nSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM\nRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVI\nYELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLER\nRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLYKELYARDK\nRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALG\nLVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLL\nWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL\nISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQK\nDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIR\nEVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSD\nSSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRA\nNSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLR\nESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPP\nQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHS\nPRDFTRMQDIPEETESRDGEAVASES",
"mw": 64.363,
"total_mw": 64.363,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "N-terminal construct of GEFH1 encompassing the C1, DH, and PH domains. C-terminal hexahistidine tag"
}
],
"buffer": {
"name": "20mM Tris-Cl, 150mM NaCl, 1mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "N-terminal domain construct of hsGEFH1_28-582aa fit to DAMMIF model and EOM",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Paul Scherrer Institut",
"webpage": null
}
],
"contributor_name": "Sung Ryul",
"contributor_surname": "Choi",
"orcid": "https://orcid.org/0000-0002-4240-2150"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2021-02-19",
"storage_temperature": null,
"cell_temperature": null,
"exposure_time": null,
"number_of_frames": null,
"wavelength": null,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": null,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.114,
"s_max": 2.045,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit1_model1_img.png",
"software": "DAMFILT",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "DAMFILT 5.0 (r13469)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit1_model1.pdb",
"model_mw": 73.59,
"bead_radius": 3.0,
"log": "https://www.sasbdb.org/media/log_files/damsel_cSH91T6.log",
"symmetry": null,
"comment": null,
"user": 1079
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit1_model2_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "dammif (r13469)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit1_model2.pdb",
"model_mw": 73.0,
"bead_radius": 2.2,
"log": null,
"symmetry": null,
"comment": null,
"user": 1079
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDV43_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 2.206,
"p_value": 0.0563,
"fit_residual_plot": "SASDV43_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDV43_fit1.fir",
"fit_log": null,
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit2_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6new",
"ext_code": "6NEW",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit2_model1.pdb",
"model_mw": 62.75,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1079
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit2_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6new",
"ext_code": "6NEW",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit2_model2.pdb",
"model_mw": 62.75,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1079
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit2_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6new",
"ext_code": "6NEW",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit2_model3.pdb",
"model_mw": 62.75,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1079
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit2_model4_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6new",
"ext_code": "6NEW",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit2_model4.pdb",
"model_mw": 62.75,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1079
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit2_model5_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6new",
"ext_code": "6NEW",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit2_model5.pdb",
"model_mw": 62.75,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1079
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit2_model6_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6new",
"ext_code": "6NEW",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit2_model6.pdb",
"model_mw": 62.75,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1079
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV43_fit2_model7_img.png",
"software": "EOM/RANCH",
"pdb_link": [
{
"pdb_code": "6new",
"ext_code": "6NEW",
"ext_type": "pdb",
"difference_with_model": "identical"
}
],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV43_fit2_model7.pdb",
"model_mw": 62.75,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1079
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDV43_fit2_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.661,
"p_value": 0.3602,
"fit_residual_plot": null,
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDV43_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 60.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 0.0208036,
"guinier_i0_error": null,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 3.746,
"guinier_rg_error": 2.945,
"pddf_dmax": null,
"pddf_dmax_error": null,
"porod_volume": null,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 12,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDV43_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-12-11T10:48:36.447050+01:00",
"bragg_peak": []
}
