Peptide-linked fusion protein of Apoptosis-inducing factor 1 AIF(104-613) point mutant W196A and the N-terminal segment of Mitochondrial intermembrane space import and assembly protein 40 CHCHD4(1-45)

{
  "code": "SASDV47",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "NADH-bound AIF activates the mitochondrial CHCHD4/MIA40 chaperone by a substrate-mimicry mechanism.",
    "publication": {
      "title": "NADH-bound AIF activates the mitochondrial CHCHD4/MIA40 chaperone by a substrate-mimicry mechanism.",
      "author_list": "Brosey CA, Shen R, Tainer JA",
      "journal": "EMBO J",
      "doi": "10.1038/s44318-024-00360-6",
      "pmid": "39806100",
      "published_date": "2025 Jan 13"
    },
    "status": "released",
    "submitted_date": "2024-09-07",
    "released_date": "2025-01-15"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDV47.dat",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDV47.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV47_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV47_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDV47_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV47_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDV47.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 X 2M",
        "resolution": 172.0
      },
      "name": "Advanced Light Source (ALS)",
      "city": "Berkeley, CA",
      "country": "USA",
      "beamline_name": "12.3.1 (SIBYLS)",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Mitochondrial intermembrane space import and assembly protein 40",
          "short_name": "CHCHD4",
          "sequence": "MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPLEVLFQ",
          "organism": "Homo sapiens",
          "uniprot_code": "Q8N4Q1",
          "uniprot_range_first": 1,
          "uniprot_range_last": 45,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMA\nSGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKP\nAEQAEETAPIEATATKEEEGSS",
          "mw": 5.876,
          "total_mw": 11.752,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "This molecule is a fusion of AIF(104-613)-W196A and the N-terminus of CHCHD4 (residues 1-45) connected by a peptide linker (SGSGPGSGS). The chimera retains residues LEVLFQ at the C-terminus from the fusion tag."
        },
        {
          "long_name": "Apoptosis-inducing factor 1, mitochondrial",
          "short_name": "AIF",
          "sequence": "MLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQANGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDSGSGPGSGS",
          "organism": "Homo sapiens",
          "uniprot_code": "O95831",
          "uniprot_range_first": 104,
          "uniprot_range_last": 613,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS\nGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEG\nEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW\nFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD\nNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV\nKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG\nVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG\nFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS\nMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE\nITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED\nLNEVAKLFNIHED",
          "mw": 56.331,
          "total_mw": 112.662,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "This molecule is a fusion of AIF(104-613)-W196A and the N-terminus of CHCHD4 (residues 1-45) connected by a peptide linker (SGSGPGSGS). The chimera retains residues LEVLFQ at the C-terminus from the fusion tag."
        }
      ],
      "buffer": {
        "name": "25 mM HEPES, 150 mM NaCl, 2 mM TCEP",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Peptide-linked fusion protein of Apoptosis-inducing factor 1 AIF(104-613) point mutant W196A and the N-terminal segment of Mitochondrial intermembrane space import and assembly protein 40 CHCHD4(1-45)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Texas, USA",
            "full_name": "MD Anderson Cancer Center",
            "webpage": "https://www.mdanderson.org/"
          }
        ],
        "contributor_name": "Chris",
        "contributor_surname": "Brosey",
        "orcid": "https://orcid.org/0000-0002-0990-0262"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2018-11-28",
    "storage_temperature": 4.0,
    "cell_temperature": 10.0,
    "exposure_time": 0.5,
    "number_of_frames": 30,
    "wavelength": 1.27,
    "sample_detector_distance": 2.0,
    "concentration_min": null,
    "concentration_max": 4.9,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.114,
    "s_max": 3.932,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ScÅtter",
  "pddf_software_version": "3.0",
  "i0_calibration_standard": null,
  "description": "Experimental molecular weight was determined by the volume of correlation (Vc) method. The real-space PDDF I(0) should be recorded as 193, based on ScAtter P(r) calculations.",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 110.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 125.0,
  "porod_mw_error": null,
  "pddf_i0": 193.0,
  "pddf_i0_error": 0.21,
  "guinier_i0": 198.121,
  "guinier_i0_error": null,
  "pddf_rg": 3.85,
  "pddf_rg_error": 0.022,
  "guinier_rg": 3.869,
  "guinier_rg_error": 0.01,
  "pddf_dmax": 12.9,
  "pddf_dmax_error": null,
  "porod_volume": 288.83,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 9,
  "guinier_point_last": 41,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDV47_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-01-15T14:59:59.774869+01:00",
  "bragg_peak": []
}

{
  "code": "SASDV47",
  "status": "success",
  "started_at": "2026-08-11T16:26:50.060560+00:00",
  "finished_at": "2026-08-11T16:26:56.543876+00:00",
  "source_last_modified": "2025-01-15T14:59:59.774869+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDV47/",
      "path": "/data/saxsdb/sasbdb/entries/47/sasdv47/source/summary.json",
      "size": 7979,
      "sha256": "cc2a8d014bbb29d4d2d6c176d0fac7da161caa548a2d9c6ca67c2aac48afdeb1"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDV47.dat",
      "path": "/data/saxsdb/sasbdb/entries/47/sasdv47/source/SASDV47.dat",
      "size": 29131,
      "sha256": "49fc104970603f45d55a5b7a7c1f986c852506653d8859045ec2fa85fd48bc42",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDV47.dat",
      "path": "/data/saxsdb/sasbdb/entries/47/sasdv47/source/SASDV47.out",
      "size": 5720,
      "sha256": "b0d1d73507f7793d2a23bce370cf2f6e3b1dee2c642190e96a7b786481975b1e",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDV47.sascif",
      "path": "/data/saxsdb/sasbdb/entries/47/sasdv47/source/SASDV47.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDV47.zip",
      "path": "/data/saxsdb/sasbdb/entries/47/sasdv47/source/SASDV47.zip",
      "size": 10851,
      "sha256": "3a9acb6cba25c8aa906dd5f40c6c31ba3b7950a675951d954185fc4cfb39f5f3",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}