The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDV76",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Conformational signatures induced by ubiquitin modification in the amyloid-forming tau repeat domain.",
"publication": {
"title": "Conformational signatures induced by ubiquitin modification in the amyloid-forming tau repeat domain.",
"author_list": "Viola G, Trivellato D, Laitaoja M, Jänis J, Felli IC, D'Onofrio M, Mollica L, Giachin G, Assfalg M",
"journal": "Proc Natl Acad Sci U S A",
"doi": "10.1073/pnas.2425831122",
"pmid": "40198698",
"published_date": "2025 Apr 15"
},
"status": "released",
"submitted_date": "2024-08-13",
"released_date": "2025-03-21"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDV76.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDV76.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV76_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV76_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDV76_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV76_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDV76.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 6M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Isoform Tau-F of Microtubule-associated protein tau (C291A, K311C, K317C, C322A)",
"short_name": "tau4RD domain",
"sequence": "MQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKAGSKDNIKHV\r\nPGGGSVQIVYCPVDLSCVTSKAGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIE",
"organism": "Homo sapiens",
"uniprot_code": "P10636",
"uniprot_range_first": 244,
"uniprot_range_last": 372,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG\nSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG\nHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPK\nTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK\nSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHV\nPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNI\nTHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV\nDSPQLATLADEVSASLAKQGL",
"mw": 13.7,
"total_mw": 13.7,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Tau4RD (Q244-E372 plus initial methionine) with C291A, C322A, K311C, K317C mutations referred to as tau4RDΔC(311/317C)"
},
{
"long_name": "Polyubiquitin-B",
"short_name": null,
"sequence": "MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF\r\nAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC",
"organism": "Fukomys damarensis",
"uniprot_code": "A0A091E260",
"uniprot_range_first": 1,
"uniprot_range_last": 77,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN\nIQKESTLHLVLRLRGGC",
"mw": 8.668,
"total_mw": 8.668,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Polyubiquitin-B",
"short_name": null,
"sequence": "MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF\r\nAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC",
"organism": "Fukomys damarensis",
"uniprot_code": "A0A091E260",
"uniprot_range_first": 1,
"uniprot_range_last": 77,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN\nIQKESTLHLVLRLRGGC",
"mw": 8.668,
"total_mw": 8.668,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "100 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.8,
"deuteration": null
},
"purity_method": null,
"name": "Microtubule-associated protein tau, lysine-rich four-repeat domain 4RD synthetically linked to two Ubiquitins at tau residues C311 and C317",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "ESRF",
"address": "Grenoble, France",
"full_name": "European Synchrotron Radiation Facility",
"webpage": "http://www.esrf.eu/"
}
],
"contributor_name": "Gabriele",
"contributor_surname": "Giachin",
"orcid": "https://orcid.org/0000-0001-7550-0307"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-03-17",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.123972,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 8.0,
"sample_volume": null,
"flow_rate": null,
"s_min": null,
"s_max": null,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV76_fit1_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV76_fit1_model1.pdb",
"model_mw": 19.58,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 388
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDV76_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.012,
"p_value": 0.95,
"fit_residual_plot": "SASDV76_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDV76_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_001_1_zfZ4GmQ.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV76_fit2_model1_img.png",
"software": "AMBER",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV76_fit2_model1.pdb",
"model_mw": 30.87,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 9
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDV76_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 9.017,
"p_value": 0.0,
"fit_residual_plot": "SASDV76_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDV76_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/Tau-diUBQ_174.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of microtubule-associated protein tau (lysine-rich four-repeat domain 4RD) synthetically linked to two ubiquitins at tau amino acids C311 and C317 in 100 mM NaCl, pH 6.8 were collected on the EMBL P12 beam line at PETRA III (DESY; Hamburg, Germany) using a Pilatus 6M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.123972 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 8.00 mg/ml was measured at 20°C. 20 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 33.8,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 36.7,
"porod_mw_error": null,
"pddf_i0": 0.3303,
"pddf_i0_error": null,
"guinier_i0": 0.328861,
"guinier_i0_error": null,
"pddf_rg": 3.384,
"pddf_rg_error": null,
"guinier_rg": 3.28,
"guinier_rg_error": 0.016,
"pddf_dmax": 12.17,
"pddf_dmax_error": null,
"porod_volume": 58.7,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 105,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDV76_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-04-10T13:15:29.994240+02:00",
"bragg_peak": []
}
