Human Splicing Factor Proline/Glutamine rich SFPQ1 dimer with C-terminal truncation (delta599-707) in low salt buffer

{
  "code": "SASDV77",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Structural dynamics of IDR interactions in human SFPQ and implications for liquid–liquid phase separation",
    "publication": {
      "title": "Structural dynamics of IDR interactions in human SFPQ and implications for liquid–liquid phase separation",
      "author_list": "Koning H, Lai V, Sethi A, Chakraborty S, Ang C, Fox A, Duff A, Whitten A, Marshall A, Bond C",
      "journal": "Acta Crystallographica Section D Structural Biology",
      "doi": "10.1107/S2059798325005303",
      "pmid": null,
      "published_date": "2025 Jun 27"
    },
    "status": "released",
    "submitted_date": "2024-09-18",
    "released_date": "2025-06-29"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDV77.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDV77.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV77_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV77_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDV77_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV77_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDV77.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 S 2M",
        "resolution": 172.0
      },
      "name": "Australian Synchrotron",
      "city": "Melbourne",
      "country": "Australia",
      "beamline_name": "SAXS/WAXS",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Splicing Factor Proline/Glutamine rich (1-598)",
          "short_name": "SFPQ1-598",
          "sequence": "GAMSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGEPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFASKPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLMRRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYS",
          "organism": "Homo sapiens",
          "uniprot_code": "P23246",
          "uniprot_range_first": 1,
          "uniprot_range_last": 598,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPI\nPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPG\nVGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQ\nAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE\nPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF\nVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGR\nQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQFGPIERAVVIVDDRGRSTGKGIVEFAS\nKPAARKAFERCSEGVFLLTTTPRPVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRF\nAQHGTFEYEYSQRWKSLDEMEKQQREQVEKNMKDAKDKLESEMEDAYHEHQANLLRQDLM\nRRQEELRRMEELHNQEMQKRKEMQLRQEEERRRREEEMMIRQREMEEQMRRQREESYSRM\nGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGS\nDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF",
          "mw": 65.148,
          "total_mw": 130.296,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "150 mM KCl, 20 mM HEPES, 5% glycerol, 5 mM MgCl2, 1 mM DTT",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Human Splicing Factor Proline/Glutamine rich SFPQ1 dimer with C-terminal truncation (delta599-707) in low salt buffer",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "The University of Western Australia",
            "webpage": null
          }
        ],
        "contributor_name": "Heidar",
        "contributor_surname": "Koning",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2023-03-13",
    "storage_temperature": 25.0,
    "cell_temperature": 25.0,
    "exposure_time": 1.0,
    "number_of_frames": 400,
    "wavelength": 0.10781,
    "sample_detector_distance": 3.0,
    "concentration_min": null,
    "concentration_max": 4.91,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.045,
    "s_max": 4.921,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "A dimer of the protein SFPQ(1-598) dialysed into a low salt buffer that appears to make the protein more compact than in a high salt buffer.\r\n\r\nThe experiment was carried out at the Australian Synchrotron SAXS/WAXS beamline with protein at 4.91 mg/ml in 150mM KCl, 20mM HEPES (pH 7.4), 5% glycerol, 5mM MgCl2, 1mM DTT.\r\n\r\nThis is part of the manuscript ' Structural dynamics of IDR interactions in human SFPQ and implications for liquid-liquid phase separation '.\r\n\r\nPorod and MW calculated using the Vp method https://doi.org/10.1002/pro.3528",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 136.738,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 260.0,
  "porod_mw_error": null,
  "pddf_i0": 0.006284,
  "pddf_i0_error": null,
  "guinier_i0": 0.00594277,
  "guinier_i0_error": null,
  "pddf_rg": 7.04,
  "pddf_rg_error": null,
  "guinier_rg": 6.052,
  "guinier_rg_error": 2.217,
  "pddf_dmax": 28.0,
  "pddf_dmax_error": null,
  "porod_volume": 315.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 2,
  "guinier_point_last": 24,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDV77_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-07-03T11:05:27.727136+02:00",
  "bragg_peak": []
}

{
  "code": "SASDV77",
  "status": "success",
  "started_at": "2026-08-11T15:23:47.461966+00:00",
  "finished_at": "2026-08-11T15:23:54.458539+00:00",
  "source_last_modified": "2025-07-03T11:05:27.727136+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDV77/",
      "path": "/data/saxsdb/sasbdb/entries/77/sasdv77/source/summary.json",
      "size": 7274,
      "sha256": "b29c6a9c19491f6e43a60f97b9744d736c7354f947982f48c8adc7e196445653"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDV77.dat",
      "path": "/data/saxsdb/sasbdb/entries/77/sasdv77/source/SASDV77.dat",
      "size": 28254,
      "sha256": "0fdd8b10754482d7c490d4080d16249a33334a53cca2168ea5ab390ef2b5a3e4",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDV77.out",
      "path": "/data/saxsdb/sasbdb/entries/77/sasdv77/source/SASDV77.out",
      "size": 21245,
      "sha256": "2413289cb5b00027027aed25e36fedcd3c67fa560a9ffd4ff15118161e10c7f3",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDV77.sascif",
      "path": "/data/saxsdb/sasbdb/entries/77/sasdv77/source/SASDV77.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDV77.zip",
      "path": "/data/saxsdb/sasbdb/entries/77/sasdv77/source/SASDV77.zip",
      "size": 16454,
      "sha256": "fd7709e7e8c894c5a4c5cf82281570b959a57dbf325838edf9305bc13897fe2b",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}