The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDV95",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Structural adaptations for carboxypeptidase activity in putative S9 acylaminoacyl peptidase from Bacillus subtilis.",
"publication": {
"title": "Structural adaptations for carboxypeptidase activity in putative S9 acylaminoacyl peptidase from Bacillus subtilis.",
"author_list": "Chandravanshi K, Singh R, Kumar A, Bhange GN, Kumar A, Makde RD",
"journal": "Int J Biol Macromol",
"doi": "10.1016/j.ijbiomac.2024.136734",
"pmid": "39433196",
"published_date": "2024 Oct 19"
},
"status": "released",
"submitted_date": "2024-07-19",
"released_date": "2024-10-23"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDV95.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDV95.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV95_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV95_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDV95_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDV95_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDV95.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "MAR 345 Image Plate",
"resolution": null
},
"name": "INDUS-2",
"city": "Indore",
"country": "India",
"beamline_name": "BL-18",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Putative acylaminoacyl-peptidase",
"short_name": "S9bs",
"sequence": "KKLITAEDITAIVSVTDPQYAPDGSRAAYVQSQVNQEKDSYTSNIWVYETKSGGSVPWTHGEKRCTDPR\r\nWSPDGRTLAFISDRDGDAAQLYIMSAEGGEARKLTDIPYGVSKPIWSPDGESVLVIVSLGEGESINDREK\r\nTEPDSFEPVEVQGLAYKRDGKGLTRGAYAQLVLVSVKSGEVKQLTNHKADHGDPAFSPDGKWLVFSANLT\r\nETNDASKPYDVCMMSLESGDLKQITSHRGSFGPSSFSTDGRYLALLGHEKEYKNATFEKAWLYDIEQDYL\r\nTCLTEMLDVHLADALIGDSLIGGAEQRPVWTKDSQGFYVIGTDQGSTGIYYISIEGLVYPIRLEKEYINS\r\nFSISPDEQHFIASVTKPDRPSELYSLPLGQEEKRLTGANDKFVSEHTISIPEDIQYVTEDGVTVNGWLMK\r\nPAQAEGKTSYPLILSIHGGPHMMYGHTYFHEFQVLAAKGYAVVYVNPRGSYGYGQEFVNAVRGDYGGKDY\r\nEDVMQAVDEAIKRDPQIDPERLGVTGGSYGGFMTNWIVGQTNRFKAAVTQRSISNWISFHGVSDIGYFFT\r\nDWQLEHDMFADTEKLWDRSPLKYAANVETPLLILHGERDDRCPIEQAEQLFIALKKIGKETMLVRFPKAS\r\nHNLSRSGHPGQRIKRLNYISSWFDQYL",
"organism": "Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)",
"uniprot_code": "E0U0N4",
"uniprot_range_first": 2,
"uniprot_range_last": 657,
"oligomerization": "tetramer",
"molecular_type": "protein",
"uniprot_sequence": "MKKLITAEDITAIVSVTDPQYAPDGSRAAYVQSQVNQEKDSYTSNIWVYETKSGGSVPWT\nHGEKRCTDPRWSPDGRTLAFISDRDGDAAQLYIMSAEGGEARKLTDIPYGVSKPIWSPDG\nESVLVIVSLGEGESINDREKTEPDSFEPVEVQGLAYKRDGKGLTRGAYAQLVLVSVKSGE\nVKQLTNHKADHGDPAFSPDGKWLVFSANLTETNDASKPYDVCMMSLESGDLKQITSHRGS\nFGPSSFSTDGRYLALLGHEKEYKNATFEKAWLYDIEQDYLTCLTEMLDVHLADALIGDSL\nIGGAEQRPVWTKDSQGFYVIGTDQGSTGIYYISIEGLVYPIRLEKEYINSFSISPDEQHF\nIASVTKPDRPSELYSLPLGQEEKRLTGANDKFVSEHTISIPEDIQYVTEDGVTVNGWLMK\nPAQAEGKTSYPLILSIHGGPHMMYGHTYFHEFQVLAAKGYAVVYVNPRGSYGYGQEFVNA\nVRGDYGGKDYEDVMQAVDEAIKRDPQIDPERLGVTGGSYGGFMTNWIVGQTNRFKAAVTQ\nRSISNWISFHGVSDIGYFFTDWQLEHDMFADTEKLWDRSPLKYAANVETPLLILHGERDD\nRCPIEQAEQLFIALKKIGKETMLVRFPKASHNLSRSGHPGQRIKRLNYISSWFDQYL",
"mw": 73.275,
"total_mw": 293.1,
"number_molecules": 4,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "10 mM Tris-HCl, 135 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "S9 carboxypeptidase from Bacillus subtilis (8 mg/ml)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Mumbai 400085, INDIA",
"full_name": "Bhabha Atomic Research Centre",
"webpage": null
}
],
"contributor_name": "Dr. Rahul",
"contributor_surname": "Singh",
"orcid": "https://orcid.org/0000-0003-4871-3600"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-03-18",
"storage_temperature": 25.0,
"cell_temperature": 25.0,
"exposure_time": null,
"number_of_frames": null,
"wavelength": 0.10332,
"sample_detector_distance": 2.2,
"concentration_min": null,
"concentration_max": 8.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.087,
"s_max": 3.69,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV95_fit1_model1_img.png",
"software": "GASBOR",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "GASBOR 2.3i (r14885)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV95_fit1_model1.cif",
"model_mw": null,
"bead_radius": null,
"log": "https://www.sasbdb.org/media/log_files/S9bs_8_S_V29OIy5.log",
"symmetry": "P4",
"comment": null,
"user": 649
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDV95_fit1_fixed_fit_img.png",
"software": "GASBOR",
"chi_square_value": 1.25,
"p_value": 0.0,
"fit_residual_plot": "SASDV95_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDV95_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/S9bs_8_S_zMbCMUV.log",
"software_version": "GASBOR 2.3i (r14885)",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDV95_fit2_model1_img.png",
"software": "AlphaFold",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "AlphaFold 3",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDV95_fit2_model1.pdb",
"model_mw": 293.5,
"bead_radius": null,
"log": null,
"symmetry": "P4",
"comment": null,
"user": 649
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDV95_fit2_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 8.956,
"p_value": 0.0,
"fit_residual_plot": "SASDV95_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDV95_fit2.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/S9BS_8mg-Ang_S9BS_EtlXEvw.log",
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of S9 carboxypeptidase from Bacillus subtilis in 10 mM Tris-HCL, 135 mM NaCl, pH 8 were collected on the BL-18 beam line at INDUS-2 (Indore, India) using a MAR 345 Image Plate detector at a sample-detector distance of 2.2 m and at a wavelength of λ = 0.10332 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 8.00 mg/ml was measured at 25°C. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 281.92,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 279.0,
"porod_mw_error": null,
"pddf_i0": 14.98,
"pddf_i0_error": null,
"guinier_i0": 15.5841,
"guinier_i0_error": null,
"pddf_rg": 4.92,
"pddf_rg_error": null,
"guinier_rg": 5.167,
"guinier_rg_error": 0.194,
"pddf_dmax": 15.3,
"pddf_dmax_error": null,
"porod_volume": 446.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 17,
"guinier_point_last": 43,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDV95_datloglog_img.png",
"symmetry": null,
"last_modified": "2024-10-24T11:10:08.118088+02:00",
"bragg_peak": []
}
