The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDVA8",
"status": "Published",
"type_of_curve": "Merged",
"angular_unit": "1/A",
"project": {
"title": "SidF, a dual substrate N5-acetyl-N5-hydroxy-L-ornithine transacetylase involved in Aspergillus fumigatus siderophore biosynthesis",
"publication": {
"title": "SidF, a dual substrate N5-acetyl-N5-hydroxy-L-ornithine transacetylase involved in Aspergillus fumigatus siderophore biosynthesis",
"author_list": "Poonsiri T, Stransky J, Demitri N, Haas H, Cianci M, Benini S",
"journal": "Journal of Structural Biology: X",
"doi": "10.1016/j.yjsbx.2024.100119",
"pmid": null,
"published_date": "2025 Jun"
},
"status": "released",
"submitted_date": "2024-10-21",
"released_date": "2025-01-02"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVA8.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVA8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVA8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVA8_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVA8_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVA8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVA8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger R 1M",
"resolution": 0.75
},
"name": "Institute of Biotechnology, Czech Academy of Sciences/Centre of Molecular Structure",
"city": "Vestec",
"country": "Czech Republic",
"beamline_name": "Anton Paar SAXSpoint 2.0",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "N(5)-hydroxyornithine:cis-anhydromevalonyl coenzyme A-N(5)-transacylase sidF",
"short_name": "SidF N-ter",
"sequence": "MGSSHHHHHHSSGENLYFQGHMATQSSTELPQINMTTAEPTSANKRTYPWVKLPHPYLTSYAIHVVSESTPRVLQLRLHDDQKGQALPEPLHSASLTYTDIAFDEAAQEIPDNDNSPWARSRRAPGTSFHWTGQEPPTLGQIWNVIHALFLTYPQHEIVRLDLNGSGKDIIREECLRTGLAVPFPSPRVPFGTENRPSETDTLILLRSAFWQGAGSPVGPR",
"organism": "Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)",
"uniprot_code": "Q4WF55",
"uniprot_range_first": 1,
"uniprot_range_last": 200,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MATQSSTELPQINMTTAEPTSANKRTYPWVKLPHPYLTSYAIHVVSESTPRVLQLRLHDD\nQKGQALPEPLHSASLTYTDIAFDEAAQEIPDNDNSPWARSRRAPGTSFHWTGQEPPTLGQ\nIWNVIHALFLTYPQHEIVRLDLNGSGKDIIREECLRTGLAVPFPSPRVPFGTENRPSETD\nTLILLRSAFWQGAGSPVGPRPIWAVDHGIHGLLRRSGSSYPPLAQNYEFSMKFPSERIYT\nRHPIRPQKPAPGSLVYSRYIPHLDQHFSLMVVDWQNEEHLQLFHKWQNDPRVAKGWNETG\nDLEHHRNYLRQLHEDKHVLCLFGRFDDFPFSYFEVYWAKEDHYGAHYDAGDYDRGRHSLV\nGESSVRGAYRVNAWWSSLIHYIFLDEPRTMCVVGEPKATNTTVLSYENAHGLTVQKYVDL\nGHKRSVHVYCSREKWFQLCPLFWDGRERPLESSDRMAWDAKL",
"mw": 24.707,
"total_mw": 24.707,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct used for SAXS contains a non-native polyhistidine tag, with additional non-native amino acids at the N-terminus (MGSSHHHHHHSSGENLYFQGH)."
}
],
"buffer": {
"name": "50 mM Tris, 200 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "The N-terminal domain of N(5)-hydroxyornithine:cis-anhydromevalonyl coenzyme A-N(5)-transacylase sidF",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Thailand",
"full_name": "Mahidol University",
"webpage": "https://mahidol.ac.th/"
}
],
"contributor_name": "Thanalai",
"contributor_surname": "Poonsiri",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-01-18",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 15.0,
"number_of_frames": 60,
"wavelength": 0.134,
"sample_detector_distance": 0.571,
"concentration_min": 5.0,
"concentration_max": 5.0,
"sample_volume": 400.0,
"flow_rate": 0.05,
"s_min": 0.141,
"s_max": 3.045,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVA8_fit1_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVA8_fit1_model1.pdb",
"model_mw": 24.26,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1131
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVA8_fit1_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVA8_fit1_model2.pdb",
"model_mw": 24.26,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1131
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVA8_fit1_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "mix",
"software_version": "2",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVA8_fit1_model3.pdb",
"model_mw": 24.26,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": null,
"user": 1131
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVA8_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.168,
"p_value": 0.0464,
"fit_residual_plot": "SASDVA8_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVA8_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_002_1_mTptFGn.log",
"software_version": "2",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of the sidF N-terminal domain in 50 mM Tris, 200 mM NaCl, pH 8 were collected using an Anton Paar SAXSpoint 2.0 instrument at the Institute of Biotechnology, Czech Academy of Sciences/Centre of Molecular Structure (Vestec, Czech Republic) equipped with an Eiger R 1M detector at a sample-detector distance of 0.6 m and at a wavelength of λ = 0.134 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). A sample concentration at 5 mg/ml was measured at 20°C. 60 successive 15 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 23.1,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 18.7,
"porod_mw_error": null,
"pddf_i0": 0.04151,
"pddf_i0_error": null,
"guinier_i0": 0.0407958,
"guinier_i0_error": null,
"pddf_rg": 2.32,
"pddf_rg_error": null,
"guinier_rg": 2.185,
"guinier_rg_error": 1.728,
"pddf_dmax": 8.9,
"pddf_dmax_error": null,
"porod_volume": 29.9,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 4,
"guinier_point_last": 40,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDVA8_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-01-02T12:10:48.691893+01:00",
"bragg_peak": []
}
